AWS certified machine learning specialty :: MLS-C01 certification guide : the definitive guide to passing the MLS-C01 exam on the very first attempt /
Prepare to achieve AWS Machine Learning Specialty certification with this complete, up-to-date guide and take the exam with confidence Key Features Get to grips with core machine learning algorithms along with AWS implementation Build model training and inference pipelines and deploy machine learnin...
Gespeichert in:
| Hauptverfasser: | , |
|---|---|
| Format: | Elektronisch E-Book |
| Sprache: | English |
| Veröffentlicht: |
Birmingham :
Packt Publishing,
2021.
|
| Schlagworte: | |
| Online-Zugang: | Volltext |
| Zusammenfassung: | Prepare to achieve AWS Machine Learning Specialty certification with this complete, up-to-date guide and take the exam with confidence Key Features Get to grips with core machine learning algorithms along with AWS implementation Build model training and inference pipelines and deploy machine learning models to the Amazon Web Services (AWS) cloud Learn all about the AWS services available for machine learning in order to pass the MLS-C01 exam Book DescriptionThe AWS Certified Machine Learning Specialty exam tests your competency to perform machine learning (ML) on AWS infrastructure. This book covers the entire exam syllabus using practical examples to help you with your real-world machine learning projects on AWS. Starting with an introduction to machine learning on AWS, you'll learn the fundamentals of machine learning and explore important AWS services for artificial intelligence (AI). You'll then see how to prepare data for machine learning and discover a wide variety of techniques for data manipulation and transformation for different types of variables. The book also shows you how to handle missing data and outliers and takes you through various machine learning tasks such as classification, regression, clustering, forecasting, anomaly detection, text mining, and image processing, along with the specific ML algorithms you need to know to pass the exam. Finally, you'll explore model evaluation, optimization, and deployment and get to grips with deploying models in a production environment and monitoring them. By the end of this book, you'll have gained knowledge of the key challenges in machine learning and the solutions that AWS has released for each of them, along with the tools, methods, and techniques commonly used in each domain of AWS ML. What you will learn Understand all four domains covered in the exam, along with types of questions, exam duration, and scoring Become well-versed with machine learning terminologies, methodologies, frameworks, and the different AWS services for machine learning Get to grips with data preparation and using AWS services for batch and real-time data processing Explore the built-in machine learning algorithms in AWS and build and deploy your own models Evaluate machine learning models and tune hyperparameters Deploy machine learning models with the AWS infrastructure Who this book is for This AWS book is for professionals and students who want to prepare for and pass the AWS Certified Machine Learning Specialty exam or gain deeper knowledge of machine learning with a special focus on AWS. Beginner-level knowledge of machine learning and AWS services is necessary before getting started with this book. |
| Beschreibung: | Table of ContentsMachine Learning FundamentalsAWS Application Services for AI/MLData preparation and transformationData understanding and visualizationAWS services for data storingAWS Services for data migration and processingMachine Learning AlgorithmsModel evaluation and optimizationSageMaker modeling. |
| Beschreibung: | 1 online resource |
| ISBN: | 1800568436 9781800568433 |
Internformat
MARC
| LEADER | 00000cam a22000001i 4500 | ||
|---|---|---|---|
| 001 | ZDB-4-EBA-on1246525528 | ||
| 003 | OCoLC | ||
| 005 | 20240705115654.0 | ||
| 006 | m d | ||
| 007 | cr ||||||||||| | ||
| 008 | 210324s2021 enk o 000 0 eng d | ||
| 040 | |a UKMGB |b eng |e rda |e pn |c UKMGB |d OCLCO |d N$T |d OCLCF |d N$T |d OCLCO |d OCLCQ |d IEEEE |d OCLCO |d OCLCL | ||
| 015 | |a GBC152705 |2 bnb | ||
| 016 | 7 | |a 020148432 |2 Uk | |
| 019 | |a 1430326716 | ||
| 020 | |a 1800568436 | ||
| 020 | |a 9781800568433 |q (electronic bk.) | ||
| 020 | |z 9781800569003 (pbk.) | ||
| 035 | |a (OCoLC)1246525528 |z (OCoLC)1430326716 | ||
| 037 | |a 9781800568433 |b Packt Publishing | ||
| 037 | |a 10163442 |b IEEE | ||
| 050 | 4 | |a QA76.585 | |
| 082 | 7 | |a 006.31 |2 23 | |
| 049 | |a MAIN | ||
| 100 | 1 | |a Nanda, Somanath, |e author. | |
| 245 | 1 | 0 | |a AWS certified machine learning specialty : |b MLS-C01 certification guide : the definitive guide to passing the MLS-C01 exam on the very first attempt / |c Somanath Nanda, Weslley Moura. |
| 264 | 1 | |a Birmingham : |b Packt Publishing, |c 2021. | |
| 300 | |a 1 online resource | ||
| 336 | |a text |2 rdacontent | ||
| 337 | |a computer |2 rdamedia | ||
| 338 | |a online resource |2 rdacarrier | ||
| 500 | |a Table of ContentsMachine Learning FundamentalsAWS Application Services for AI/MLData preparation and transformationData understanding and visualizationAWS services for data storingAWS Services for data migration and processingMachine Learning AlgorithmsModel evaluation and optimizationSageMaker modeling. | ||
| 588 | |a Description based on CIP data; resource not viewed. | ||
| 520 | |a Prepare to achieve AWS Machine Learning Specialty certification with this complete, up-to-date guide and take the exam with confidence Key Features Get to grips with core machine learning algorithms along with AWS implementation Build model training and inference pipelines and deploy machine learning models to the Amazon Web Services (AWS) cloud Learn all about the AWS services available for machine learning in order to pass the MLS-C01 exam Book DescriptionThe AWS Certified Machine Learning Specialty exam tests your competency to perform machine learning (ML) on AWS infrastructure. This book covers the entire exam syllabus using practical examples to help you with your real-world machine learning projects on AWS. Starting with an introduction to machine learning on AWS, you'll learn the fundamentals of machine learning and explore important AWS services for artificial intelligence (AI). You'll then see how to prepare data for machine learning and discover a wide variety of techniques for data manipulation and transformation for different types of variables. The book also shows you how to handle missing data and outliers and takes you through various machine learning tasks such as classification, regression, clustering, forecasting, anomaly detection, text mining, and image processing, along with the specific ML algorithms you need to know to pass the exam. Finally, you'll explore model evaluation, optimization, and deployment and get to grips with deploying models in a production environment and monitoring them. By the end of this book, you'll have gained knowledge of the key challenges in machine learning and the solutions that AWS has released for each of them, along with the tools, methods, and techniques commonly used in each domain of AWS ML. What you will learn Understand all four domains covered in the exam, along with types of questions, exam duration, and scoring Become well-versed with machine learning terminologies, methodologies, frameworks, and the different AWS services for machine learning Get to grips with data preparation and using AWS services for batch and real-time data processing Explore the built-in machine learning algorithms in AWS and build and deploy your own models Evaluate machine learning models and tune hyperparameters Deploy machine learning models with the AWS infrastructure Who this book is for This AWS book is for professionals and students who want to prepare for and pass the AWS Certified Machine Learning Specialty exam or gain deeper knowledge of machine learning with a special focus on AWS. Beginner-level knowledge of machine learning and AWS services is necessary before getting started with this book. | ||
| 505 | 0 | |a Table of Contents Machine Learning Fundamentals AWS Application Services for AI/ML Data preparation and transformation Data understanding and visualization AWS services for data storing AWS Services for data migration and processing Machine Learning Algorithms Model evaluation and optimization SageMaker modeling. | |
| 630 | 0 | 0 | |a Amazon Web Services. |
| 650 | 0 | |a Cloud computing |x Examination |v Study guides. | |
| 650 | 0 | |a Web services |x Examinations |v Study guides. | |
| 650 | 0 | |a Machine learning |x Examinations |v Study guides. | |
| 650 | 6 | |a Infonuagique |x Examen |v Guides de l'étudiant. | |
| 650 | 6 | |a Services Web |x Examens |v Guides de l'étudiant. | |
| 650 | 6 | |a Apprentissage automatique |x Examens |v Guides de l'étudiant. | |
| 650 | 7 | |a Cloud computing |2 fast | |
| 655 | 7 | |a Study guides |2 fast | |
| 700 | 1 | |a Moura, Weslley, |e author. | |
| 758 | |i has work: |a AWS Certified Machine Learning Specialty (Text) |1 https://id.oclc.org/worldcat/entity/E39PCYRvR33M7fk9CVvC6x9H98 |4 https://id.oclc.org/worldcat/ontology/hasWork | ||
| 776 | 0 | 8 | |i Print version: |z 9781800569003 |
| 856 | 1 | |l FWS01 |p ZDB-4-EBA |q FWS_PDA_EBA |u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=2894693 |3 Volltext | |
| 856 | 1 | |l CBO01 |p ZDB-4-EBA |q FWS_PDA_EBA |u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=2894693 |3 Volltext | |
| 938 | |a EBSCOhost |b EBSC |n 2894693 | ||
| 994 | |a 92 |b GEBAY | ||
| 912 | |a ZDB-4-EBA | ||
Datensatz im Suchindex
| DE-BY-FWS_katkey | ZDB-4-EBA-on1246525528 |
|---|---|
| _version_ | 1813901700014014464 |
| adam_text | |
| any_adam_object | |
| author | Nanda, Somanath Moura, Weslley |
| author_facet | Nanda, Somanath Moura, Weslley |
| author_role | aut aut |
| author_sort | Nanda, Somanath |
| author_variant | s n sn w m wm |
| building | Verbundindex |
| bvnumber | localFWS |
| callnumber-first | Q - Science |
| callnumber-label | QA76 |
| callnumber-raw | QA76.585 |
| callnumber-search | QA76.585 |
| callnumber-sort | QA 276.585 |
| callnumber-subject | QA - Mathematics |
| collection | ZDB-4-EBA |
| contents | Table of Contents Machine Learning Fundamentals AWS Application Services for AI/ML Data preparation and transformation Data understanding and visualization AWS services for data storing AWS Services for data migration and processing Machine Learning Algorithms Model evaluation and optimization SageMaker modeling. |
| ctrlnum | (OCoLC)1246525528 |
| dewey-full | 006.31 |
| dewey-hundreds | 000 - Computer science, information, general works |
| dewey-ones | 006 - Special computer methods |
| dewey-raw | 006.31 |
| dewey-search | 006.31 |
| dewey-sort | 16.31 |
| dewey-tens | 000 - Computer science, information, general works |
| discipline | Informatik |
| format | Electronic eBook |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>05514cam a22005651i 4500</leader><controlfield tag="001">ZDB-4-EBA-on1246525528</controlfield><controlfield tag="003">OCoLC</controlfield><controlfield tag="005">20240705115654.0</controlfield><controlfield tag="006">m d </controlfield><controlfield tag="007">cr |||||||||||</controlfield><controlfield tag="008">210324s2021 enk o 000 0 eng d</controlfield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">UKMGB</subfield><subfield code="b">eng</subfield><subfield code="e">rda</subfield><subfield code="e">pn</subfield><subfield code="c">UKMGB</subfield><subfield code="d">OCLCO</subfield><subfield code="d">N$T</subfield><subfield code="d">OCLCF</subfield><subfield code="d">N$T</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">IEEEE</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCL</subfield></datafield><datafield tag="015" ind1=" " ind2=" "><subfield code="a">GBC152705</subfield><subfield code="2">bnb</subfield></datafield><datafield tag="016" ind1="7" ind2=" "><subfield code="a">020148432</subfield><subfield code="2">Uk</subfield></datafield><datafield tag="019" ind1=" " ind2=" "><subfield code="a">1430326716</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">1800568436</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781800568433</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">9781800569003 (pbk.)</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1246525528</subfield><subfield code="z">(OCoLC)1430326716</subfield></datafield><datafield tag="037" ind1=" " ind2=" "><subfield code="a">9781800568433</subfield><subfield code="b">Packt Publishing</subfield></datafield><datafield tag="037" ind1=" " ind2=" "><subfield code="a">10163442</subfield><subfield code="b">IEEE</subfield></datafield><datafield tag="050" ind1=" " ind2="4"><subfield code="a">QA76.585</subfield></datafield><datafield tag="082" ind1="7" ind2=" "><subfield code="a">006.31</subfield><subfield code="2">23</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">MAIN</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Nanda, Somanath,</subfield><subfield code="e">author.</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">AWS certified machine learning specialty :</subfield><subfield code="b">MLS-C01 certification guide : the definitive guide to passing the MLS-C01 exam on the very first attempt /</subfield><subfield code="c">Somanath Nanda, Weslley Moura.</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Birmingham :</subfield><subfield code="b">Packt Publishing,</subfield><subfield code="c">2021.</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">text</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">computer</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">online resource</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Table of ContentsMachine Learning FundamentalsAWS Application Services for AI/MLData preparation and transformationData understanding and visualizationAWS services for data storingAWS Services for data migration and processingMachine Learning AlgorithmsModel evaluation and optimizationSageMaker modeling.</subfield></datafield><datafield tag="588" ind1=" " ind2=" "><subfield code="a">Description based on CIP data; resource not viewed.</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Prepare to achieve AWS Machine Learning Specialty certification with this complete, up-to-date guide and take the exam with confidence Key Features Get to grips with core machine learning algorithms along with AWS implementation Build model training and inference pipelines and deploy machine learning models to the Amazon Web Services (AWS) cloud Learn all about the AWS services available for machine learning in order to pass the MLS-C01 exam Book DescriptionThe AWS Certified Machine Learning Specialty exam tests your competency to perform machine learning (ML) on AWS infrastructure. This book covers the entire exam syllabus using practical examples to help you with your real-world machine learning projects on AWS. Starting with an introduction to machine learning on AWS, you'll learn the fundamentals of machine learning and explore important AWS services for artificial intelligence (AI). You'll then see how to prepare data for machine learning and discover a wide variety of techniques for data manipulation and transformation for different types of variables. The book also shows you how to handle missing data and outliers and takes you through various machine learning tasks such as classification, regression, clustering, forecasting, anomaly detection, text mining, and image processing, along with the specific ML algorithms you need to know to pass the exam. Finally, you'll explore model evaluation, optimization, and deployment and get to grips with deploying models in a production environment and monitoring them. By the end of this book, you'll have gained knowledge of the key challenges in machine learning and the solutions that AWS has released for each of them, along with the tools, methods, and techniques commonly used in each domain of AWS ML. What you will learn Understand all four domains covered in the exam, along with types of questions, exam duration, and scoring Become well-versed with machine learning terminologies, methodologies, frameworks, and the different AWS services for machine learning Get to grips with data preparation and using AWS services for batch and real-time data processing Explore the built-in machine learning algorithms in AWS and build and deploy your own models Evaluate machine learning models and tune hyperparameters Deploy machine learning models with the AWS infrastructure Who this book is for This AWS book is for professionals and students who want to prepare for and pass the AWS Certified Machine Learning Specialty exam or gain deeper knowledge of machine learning with a special focus on AWS. Beginner-level knowledge of machine learning and AWS services is necessary before getting started with this book.</subfield></datafield><datafield tag="505" ind1="0" ind2=" "><subfield code="a">Table of Contents Machine Learning Fundamentals AWS Application Services for AI/ML Data preparation and transformation Data understanding and visualization AWS services for data storing AWS Services for data migration and processing Machine Learning Algorithms Model evaluation and optimization SageMaker modeling.</subfield></datafield><datafield tag="630" ind1="0" ind2="0"><subfield code="a">Amazon Web Services.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Cloud computing</subfield><subfield code="x">Examination</subfield><subfield code="v">Study guides.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Web services</subfield><subfield code="x">Examinations</subfield><subfield code="v">Study guides.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Machine learning</subfield><subfield code="x">Examinations</subfield><subfield code="v">Study guides.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Infonuagique</subfield><subfield code="x">Examen</subfield><subfield code="v">Guides de l'étudiant.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Services Web</subfield><subfield code="x">Examens</subfield><subfield code="v">Guides de l'étudiant.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Apprentissage automatique</subfield><subfield code="x">Examens</subfield><subfield code="v">Guides de l'étudiant.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Cloud computing</subfield><subfield code="2">fast</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">Study guides</subfield><subfield code="2">fast</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Moura, Weslley,</subfield><subfield code="e">author.</subfield></datafield><datafield tag="758" ind1=" " ind2=" "><subfield code="i">has work:</subfield><subfield code="a">AWS Certified Machine Learning Specialty (Text)</subfield><subfield code="1">https://id.oclc.org/worldcat/entity/E39PCYRvR33M7fk9CVvC6x9H98</subfield><subfield code="4">https://id.oclc.org/worldcat/ontology/hasWork</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Print version:</subfield><subfield code="z">9781800569003</subfield></datafield><datafield tag="856" ind1="1" ind2=" "><subfield code="l">FWS01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=2894693</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="856" ind1="1" ind2=" "><subfield code="l">CBO01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=2894693</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">EBSCOhost</subfield><subfield code="b">EBSC</subfield><subfield code="n">2894693</subfield></datafield><datafield tag="994" ind1=" " ind2=" "><subfield code="a">92</subfield><subfield code="b">GEBAY</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield></record></collection> |
| genre | Study guides fast |
| genre_facet | Study guides |
| id | ZDB-4-EBA-on1246525528 |
| illustrated | Not Illustrated |
| indexdate | 2024-10-25T15:51:03Z |
| institution | BVB |
| isbn | 1800568436 9781800568433 |
| language | English |
| oclc_num | 1246525528 |
| open_access_boolean | |
| owner | MAIN |
| owner_facet | MAIN |
| physical | 1 online resource |
| psigel | ZDB-4-EBA |
| publishDate | 2021 |
| publishDateSearch | 2021 |
| publishDateSort | 2021 |
| publisher | Packt Publishing, |
| record_format | marc |
| spelling | Nanda, Somanath, author. AWS certified machine learning specialty : MLS-C01 certification guide : the definitive guide to passing the MLS-C01 exam on the very first attempt / Somanath Nanda, Weslley Moura. Birmingham : Packt Publishing, 2021. 1 online resource text rdacontent computer rdamedia online resource rdacarrier Table of ContentsMachine Learning FundamentalsAWS Application Services for AI/MLData preparation and transformationData understanding and visualizationAWS services for data storingAWS Services for data migration and processingMachine Learning AlgorithmsModel evaluation and optimizationSageMaker modeling. Description based on CIP data; resource not viewed. Prepare to achieve AWS Machine Learning Specialty certification with this complete, up-to-date guide and take the exam with confidence Key Features Get to grips with core machine learning algorithms along with AWS implementation Build model training and inference pipelines and deploy machine learning models to the Amazon Web Services (AWS) cloud Learn all about the AWS services available for machine learning in order to pass the MLS-C01 exam Book DescriptionThe AWS Certified Machine Learning Specialty exam tests your competency to perform machine learning (ML) on AWS infrastructure. This book covers the entire exam syllabus using practical examples to help you with your real-world machine learning projects on AWS. Starting with an introduction to machine learning on AWS, you'll learn the fundamentals of machine learning and explore important AWS services for artificial intelligence (AI). You'll then see how to prepare data for machine learning and discover a wide variety of techniques for data manipulation and transformation for different types of variables. The book also shows you how to handle missing data and outliers and takes you through various machine learning tasks such as classification, regression, clustering, forecasting, anomaly detection, text mining, and image processing, along with the specific ML algorithms you need to know to pass the exam. Finally, you'll explore model evaluation, optimization, and deployment and get to grips with deploying models in a production environment and monitoring them. By the end of this book, you'll have gained knowledge of the key challenges in machine learning and the solutions that AWS has released for each of them, along with the tools, methods, and techniques commonly used in each domain of AWS ML. What you will learn Understand all four domains covered in the exam, along with types of questions, exam duration, and scoring Become well-versed with machine learning terminologies, methodologies, frameworks, and the different AWS services for machine learning Get to grips with data preparation and using AWS services for batch and real-time data processing Explore the built-in machine learning algorithms in AWS and build and deploy your own models Evaluate machine learning models and tune hyperparameters Deploy machine learning models with the AWS infrastructure Who this book is for This AWS book is for professionals and students who want to prepare for and pass the AWS Certified Machine Learning Specialty exam or gain deeper knowledge of machine learning with a special focus on AWS. Beginner-level knowledge of machine learning and AWS services is necessary before getting started with this book. Table of Contents Machine Learning Fundamentals AWS Application Services for AI/ML Data preparation and transformation Data understanding and visualization AWS services for data storing AWS Services for data migration and processing Machine Learning Algorithms Model evaluation and optimization SageMaker modeling. Amazon Web Services. Cloud computing Examination Study guides. Web services Examinations Study guides. Machine learning Examinations Study guides. Infonuagique Examen Guides de l'étudiant. Services Web Examens Guides de l'étudiant. Apprentissage automatique Examens Guides de l'étudiant. Cloud computing fast Study guides fast Moura, Weslley, author. has work: AWS Certified Machine Learning Specialty (Text) https://id.oclc.org/worldcat/entity/E39PCYRvR33M7fk9CVvC6x9H98 https://id.oclc.org/worldcat/ontology/hasWork Print version: 9781800569003 FWS01 ZDB-4-EBA FWS_PDA_EBA https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=2894693 Volltext CBO01 ZDB-4-EBA FWS_PDA_EBA https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=2894693 Volltext |
| spellingShingle | Nanda, Somanath Moura, Weslley AWS certified machine learning specialty : MLS-C01 certification guide : the definitive guide to passing the MLS-C01 exam on the very first attempt / Table of Contents Machine Learning Fundamentals AWS Application Services for AI/ML Data preparation and transformation Data understanding and visualization AWS services for data storing AWS Services for data migration and processing Machine Learning Algorithms Model evaluation and optimization SageMaker modeling. Amazon Web Services. Cloud computing Examination Study guides. Web services Examinations Study guides. Machine learning Examinations Study guides. Infonuagique Examen Guides de l'étudiant. Services Web Examens Guides de l'étudiant. Apprentissage automatique Examens Guides de l'étudiant. Cloud computing fast |
| title | AWS certified machine learning specialty : MLS-C01 certification guide : the definitive guide to passing the MLS-C01 exam on the very first attempt / |
| title_auth | AWS certified machine learning specialty : MLS-C01 certification guide : the definitive guide to passing the MLS-C01 exam on the very first attempt / |
| title_exact_search | AWS certified machine learning specialty : MLS-C01 certification guide : the definitive guide to passing the MLS-C01 exam on the very first attempt / |
| title_full | AWS certified machine learning specialty : MLS-C01 certification guide : the definitive guide to passing the MLS-C01 exam on the very first attempt / Somanath Nanda, Weslley Moura. |
| title_fullStr | AWS certified machine learning specialty : MLS-C01 certification guide : the definitive guide to passing the MLS-C01 exam on the very first attempt / Somanath Nanda, Weslley Moura. |
| title_full_unstemmed | AWS certified machine learning specialty : MLS-C01 certification guide : the definitive guide to passing the MLS-C01 exam on the very first attempt / Somanath Nanda, Weslley Moura. |
| title_short | AWS certified machine learning specialty : |
| title_sort | aws certified machine learning specialty mls c01 certification guide the definitive guide to passing the mls c01 exam on the very first attempt |
| title_sub | MLS-C01 certification guide : the definitive guide to passing the MLS-C01 exam on the very first attempt / |
| topic | Amazon Web Services. Cloud computing Examination Study guides. Web services Examinations Study guides. Machine learning Examinations Study guides. Infonuagique Examen Guides de l'étudiant. Services Web Examens Guides de l'étudiant. Apprentissage automatique Examens Guides de l'étudiant. Cloud computing fast |
| topic_facet | Amazon Web Services. Cloud computing Examination Study guides. Web services Examinations Study guides. Machine learning Examinations Study guides. Infonuagique Examen Guides de l'étudiant. Services Web Examens Guides de l'étudiant. Apprentissage automatique Examens Guides de l'étudiant. Cloud computing Study guides |
| url | https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=2894693 |
| work_keys_str_mv | AT nandasomanath awscertifiedmachinelearningspecialtymlsc01certificationguidethedefinitiveguidetopassingthemlsc01examontheveryfirstattempt AT mouraweslley awscertifiedmachinelearningspecialtymlsc01certificationguidethedefinitiveguidetopassingthemlsc01examontheveryfirstattempt |