Current Micro-Nano Science and Technology :: Selected, Peer Reviewed Papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China /
Collection of selected, peer reviewed papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China. The 46 papers are grouped as follows:. Chapter 1: Synthesis and Preparation of Nanomaterials;. Chapter 2: Nanotechnologies and Nanomaterials: Fron...
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Körperschaft: | |
| Weitere Verfasser: | , |
| Format: | Elektronisch Tagungsbericht E-Book |
| Sprache: | English |
| Veröffentlicht: |
Zurich :
Trans Tech Publishers,
©2015.
|
| Schriftenreihe: | Advanced materials research ;
v. 1118. |
| Schlagworte: | |
| Online-Zugang: | Volltext |
| Zusammenfassung: | Collection of selected, peer reviewed papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China. The 46 papers are grouped as follows:. Chapter 1: Synthesis and Preparation of Nanomaterials;. Chapter 2: Nanotechnologies and Nanomaterials: Frontiers of Application and Properties;. Chapter 3: Frontiers of Micro-Materials and Technologies, Applications Keyword: Nanomaterials, Nanofabrication, Microfabrication, MEMS, Nanotechnology, Sensors, photolithography This book is a collection of more than 40 peer-reviewed papers from the 13th China International Nanoscience and Technology Symposium held in October 2014. |
| Beschreibung: | A Novel hig E Aptamer Biosensor Base on Core-Shell Fe3O4@Au Magnetic Composite Nanoparticles. |
| Beschreibung: | 1 online resource (297 pages) : illustrations (some color) |
| Bibliographie: | Includes bibliographical references. |
| ISBN: | 9783038269267 3038269263 |
Internformat
MARC
| LEADER | 00000cam a2200000 i 4500 | ||
|---|---|---|---|
| 001 | ZDB-4-EBA-ocn916954406 | ||
| 003 | OCoLC | ||
| 005 | 20241004212047.0 | ||
| 006 | m o d | ||
| 007 | cr ||||||||||| | ||
| 008 | 150808s2015 sz a ob 100 0 eng d | ||
| 040 | |a EBLCP |b eng |e pn |c EBLCP |d OCLCO |d CUS |d OCLCO |d YDXCP |d N$T |d OCLCO |d OCLCF |d OCLCO |d OCLCQ |d OCLCO |d OCLCQ |d OCLCO |d AGLDB |d ICA |d D6H |d OCLCQ |d VTS |d STF |d M8D |d OCLCQ |d OCLCO |d OCLCQ |d TTECH |d AJS |d OCLCO |d OCLCQ |d OCLCO |d OCLCL |d OCLCQ | ||
| 020 | |a 9783038269267 |q (electronic bk.) | ||
| 020 | |a 3038269263 |q (electronic bk.) | ||
| 035 | |a (OCoLC)916954406 | ||
| 050 | 4 | |a TA418.9.N35 | |
| 072 | 7 | |a TEC |x 009000 |2 bisacsh | |
| 072 | 7 | |a TEC |x 035000 |2 bisacsh | |
| 082 | 7 | |a 620.5 | |
| 049 | |a MAIN | ||
| 111 | 2 | |a China International Nanoscience And Technology Symposium |n (13th : |d 2014 : |c Chengdu, China) | |
| 245 | 1 | 0 | |a Current Micro-Nano Science and Technology : |b Selected, Peer Reviewed Papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China / |c edited by Hailin Cong, Bing Yu and Xing Lu. |
| 260 | |a Zurich : |b Trans Tech Publishers, |c ©2015. | ||
| 300 | |a 1 online resource (297 pages) : |b illustrations (some color) | ||
| 336 | |a text |b txt |2 rdacontent | ||
| 337 | |a computer |b c |2 rdamedia | ||
| 338 | |a online resource |b cr |2 rdacarrier | ||
| 490 | 1 | |a Advanced Materials Research ; |v v. 1118 | |
| 588 | 0 | |a Print version record. | |
| 505 | 0 | |a Current Micro-Nano Science and Technology; Preface, Committees and Sponsors; Table of Contents; Chapter 1: Synthesis and Preparation of Nanomaterials; Fabrication of Sub-Wavelength Antireflective Structures Using a Soft Roll-to-Plate Nanoimprinting Lithographic Method; One-Pot Synthesis of Environmental Friendly Ni3S2 Quantum Dots; Palladium Nanoparticles Synthesized by Bio-Templates for Suzuki Coupling Reaction; Pd/SiO2 Organic-Inorganic Hybrid Materials by Sol-Gel Method: Preparation and Thermal Stability under H2 Atmosphere. | |
| 505 | 8 | |a Preparation and Comparatively Evaluation of Phenylethyl Resorcinol-Loaded Nanocarriers : Nanoemulsions and Nanostructured Lipid Carriers; Study on the Preparation Conditions of Nano-Silver Substrate Used for SERS Determination of Thiophene; Synthesis and Characterization of In2O3 Nanobelts via Hydrothermal Route; Synthesis of CeO2-SiO2 Composite Nanoparticles by Coprecipitation Method and Dispersion Stability of their Suspension; Synthesis, Photoluminescence and Infrared Emissivity of SnO2 Nanocrystalline Thin Films; The Standard Formation Enthalpies of Spherical ZnO Nano-Particles: Size Matters. | |
| 505 | 8 | |a The Synthesis and Property of Neutral Silicone Glass Sealant; Influence of Calcination Temperature on the Performance of TiO2 Films in Dye-Sensitized Solar Cells; Enhancement of Luminescence of YPO4:Eu3+, Yb3+ Nanophosphor Synthesized by Hydrothermal Method; Effect of Sm-Au on Silver Staining Results and it ́s UV-Vis Absorption Spectrum; Rapid, Simple and Selective Determination of 2,4,6-dinitrophenol Based on PtAg /Mesoporous SiO2 Nanocomposite Sensor with Electrochemical Detection; Fabrication and Characterization of LaOBr:Eu3+ Luminescent Nanofibers. | |
| 505 | 8 | |a Preparation and Characterization of Nanometer Gallium Nitride by Gas-Solid Reaction; Refluxing Synthesis and Characterization of ZnO Nanopowders from Different Zinc Salts; Chapter 2: Nanotechnologies and Nanomaterials: Frontiers of Application and Properties; The Structural and Optical Properties of Be-Doped GaAs Grown by MBE; The Influence of Emulsifiers on the Formation of Res-Loaded Nanostructured Lipid Carriers; Near-Infrared Reflection Spectra of Copper Nanowire Array Structures; Investigation onto Nanometer Delay Charges for Millisecond Blasting Caps. | |
| 505 | 8 | |a Investigation of Cu Species in CuBTC: Active Sites for Selective Catalytic Reduction of NO with NH3; Influence of Exposure Time on the Photosensitive Properties of Borosilicate Photosensitive Glass-Ceramics; A Theoretical Study of Nonlinear Optical Properties for Stilbene Grafted to Carbon Nanotubes; The Surface and Photoluminescence Properties of GaAs Passivated by Wet Chemical Method; The Surface Plasmon Resonance Absorption of Indium Tin Oxide Nanoparticles and its Control; 1200 Mesh Silicon Carbide Corona Protection Varnish with Epoxy/OMMT Nano-Composite Adhesive. | |
| 500 | |a A Novel hig E Aptamer Biosensor Base on Core-Shell Fe3O4@Au Magnetic Composite Nanoparticles. | ||
| 520 | |a Collection of selected, peer reviewed papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China. The 46 papers are grouped as follows:. Chapter 1: Synthesis and Preparation of Nanomaterials;. Chapter 2: Nanotechnologies and Nanomaterials: Frontiers of Application and Properties;. Chapter 3: Frontiers of Micro-Materials and Technologies, Applications Keyword: Nanomaterials, Nanofabrication, Microfabrication, MEMS, Nanotechnology, Sensors, photolithography This book is a collection of more than 40 peer-reviewed papers from the 13th China International Nanoscience and Technology Symposium held in October 2014. | ||
| 504 | |a Includes bibliographical references. | ||
| 650 | 0 | |a Mechatronics |v Congresses. | |
| 650 | 0 | |a Micromechanics |v Congresses. | |
| 650 | 0 | |a Nanostructured materials |v Congresses. | |
| 650 | 0 | |a Nanotechnology |v Congresses. | |
| 650 | 6 | |a Mécatronique |v Congrès. | |
| 650 | 6 | |a Micromécanique |v Congrès. | |
| 650 | 6 | |a Nanomatériaux |v Congrès. | |
| 650 | 6 | |a Nanotechnologie |v Congrès. | |
| 650 | 7 | |a TECHNOLOGY & ENGINEERING |x Engineering (General) |2 bisacsh | |
| 650 | 7 | |a TECHNOLOGY & ENGINEERING |x Reference. |2 bisacsh | |
| 650 | 7 | |a Mechatronics |2 fast | |
| 650 | 7 | |a Micromechanics |2 fast | |
| 650 | 7 | |a Nanostructured materials |2 fast | |
| 650 | 7 | |a Nanotechnology |2 fast | |
| 655 | 7 | |a Conference papers and proceedings |2 fast | |
| 700 | 1 | |a Cong, Hailin, |e author. |0 http://id.loc.gov/authorities/names/nb2010011208 | |
| 700 | 1 | |a Yu, Bing, |e editor. | |
| 700 | 1 | |a Lu, Xing, |e editor. | |
| 758 | |i has work: |a Current Micro-Nano Science and Technology (Text) |1 https://id.oclc.org/worldcat/entity/E39PCGwkRqP63FwKYMwvJhWbV3 |4 https://id.oclc.org/worldcat/ontology/hasWork | ||
| 776 | 0 | 8 | |i Print version: |a Cong, Hailin. |t Current Micro-Nano Science and Technology : Selected, Peer Reviewed Papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China. |d Zurich : Trans Tech Publishers, ©2015 |z 9783038354642 |
| 830 | 0 | |a Advanced materials research ; |v v. 1118. |0 http://id.loc.gov/authorities/names/n99255722 | |
| 856 | 4 | 0 | |l FWS01 |p ZDB-4-EBA |q FWS_PDA_EBA |u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=1049007 |3 Volltext |
| 938 | |a Trans Tech Publications, Ltd |b TRAN |n 10.4028/www.scientific.net/AMR.1118 | ||
| 938 | |a ProQuest Ebook Central |b EBLB |n EBL2123552 | ||
| 938 | |a EBSCOhost |b EBSC |n 1049007 | ||
| 938 | |a YBP Library Services |b YANK |n 12562628 | ||
| 994 | |a 92 |b GEBAY | ||
| 912 | |a ZDB-4-EBA | ||
| 049 | |a DE-863 | ||
Datensatz im Suchindex
| DE-BY-FWS_katkey | ZDB-4-EBA-ocn916954406 |
|---|---|
| _version_ | 1816882320330719232 |
| adam_text | |
| any_adam_object | |
| author | Cong, Hailin |
| author2 | Yu, Bing Lu, Xing |
| author2_role | edt edt |
| author2_variant | b y by x l xl |
| author_GND | http://id.loc.gov/authorities/names/nb2010011208 |
| author_corporate | China International Nanoscience And Technology Symposium Chengdu, China |
| author_corporate_role | |
| author_facet | Cong, Hailin Yu, Bing Lu, Xing China International Nanoscience And Technology Symposium Chengdu, China |
| author_role | aut |
| author_sort | China International Nanoscience And Technology Symposium Chengdu, China |
| author_variant | h c hc |
| building | Verbundindex |
| bvnumber | localFWS |
| callnumber-first | T - Technology |
| callnumber-label | TA418 |
| callnumber-raw | TA418.9.N35 |
| callnumber-search | TA418.9.N35 |
| callnumber-sort | TA 3418.9 N35 |
| callnumber-subject | TA - General and Civil Engineering |
| collection | ZDB-4-EBA |
| contents | Current Micro-Nano Science and Technology; Preface, Committees and Sponsors; Table of Contents; Chapter 1: Synthesis and Preparation of Nanomaterials; Fabrication of Sub-Wavelength Antireflective Structures Using a Soft Roll-to-Plate Nanoimprinting Lithographic Method; One-Pot Synthesis of Environmental Friendly Ni3S2 Quantum Dots; Palladium Nanoparticles Synthesized by Bio-Templates for Suzuki Coupling Reaction; Pd/SiO2 Organic-Inorganic Hybrid Materials by Sol-Gel Method: Preparation and Thermal Stability under H2 Atmosphere. Preparation and Comparatively Evaluation of Phenylethyl Resorcinol-Loaded Nanocarriers : Nanoemulsions and Nanostructured Lipid Carriers; Study on the Preparation Conditions of Nano-Silver Substrate Used for SERS Determination of Thiophene; Synthesis and Characterization of In2O3 Nanobelts via Hydrothermal Route; Synthesis of CeO2-SiO2 Composite Nanoparticles by Coprecipitation Method and Dispersion Stability of their Suspension; Synthesis, Photoluminescence and Infrared Emissivity of SnO2 Nanocrystalline Thin Films; The Standard Formation Enthalpies of Spherical ZnO Nano-Particles: Size Matters. The Synthesis and Property of Neutral Silicone Glass Sealant; Influence of Calcination Temperature on the Performance of TiO2 Films in Dye-Sensitized Solar Cells; Enhancement of Luminescence of YPO4:Eu3+, Yb3+ Nanophosphor Synthesized by Hydrothermal Method; Effect of Sm-Au on Silver Staining Results and it ́s UV-Vis Absorption Spectrum; Rapid, Simple and Selective Determination of 2,4,6-dinitrophenol Based on PtAg /Mesoporous SiO2 Nanocomposite Sensor with Electrochemical Detection; Fabrication and Characterization of LaOBr:Eu3+ Luminescent Nanofibers. Preparation and Characterization of Nanometer Gallium Nitride by Gas-Solid Reaction; Refluxing Synthesis and Characterization of ZnO Nanopowders from Different Zinc Salts; Chapter 2: Nanotechnologies and Nanomaterials: Frontiers of Application and Properties; The Structural and Optical Properties of Be-Doped GaAs Grown by MBE; The Influence of Emulsifiers on the Formation of Res-Loaded Nanostructured Lipid Carriers; Near-Infrared Reflection Spectra of Copper Nanowire Array Structures; Investigation onto Nanometer Delay Charges for Millisecond Blasting Caps. Investigation of Cu Species in CuBTC: Active Sites for Selective Catalytic Reduction of NO with NH3; Influence of Exposure Time on the Photosensitive Properties of Borosilicate Photosensitive Glass-Ceramics; A Theoretical Study of Nonlinear Optical Properties for Stilbene Grafted to Carbon Nanotubes; The Surface and Photoluminescence Properties of GaAs Passivated by Wet Chemical Method; The Surface Plasmon Resonance Absorption of Indium Tin Oxide Nanoparticles and its Control; 1200 Mesh Silicon Carbide Corona Protection Varnish with Epoxy/OMMT Nano-Composite Adhesive. |
| ctrlnum | (OCoLC)916954406 |
| dewey-full | 620.5 |
| dewey-hundreds | 600 - Technology (Applied sciences) |
| dewey-ones | 620 - Engineering and allied operations |
| dewey-raw | 620.5 |
| dewey-search | 620.5 |
| dewey-sort | 3620.5 |
| dewey-tens | 620 - Engineering and allied operations |
| format | Electronic Conference Proceeding eBook |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>06985cam a2200733 i 4500</leader><controlfield tag="001">ZDB-4-EBA-ocn916954406</controlfield><controlfield tag="003">OCoLC</controlfield><controlfield tag="005">20241004212047.0</controlfield><controlfield tag="006">m o d </controlfield><controlfield tag="007">cr |||||||||||</controlfield><controlfield tag="008">150808s2015 sz a ob 100 0 eng d</controlfield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">EBLCP</subfield><subfield code="b">eng</subfield><subfield code="e">pn</subfield><subfield code="c">EBLCP</subfield><subfield code="d">OCLCO</subfield><subfield code="d">CUS</subfield><subfield code="d">OCLCO</subfield><subfield code="d">YDXCP</subfield><subfield code="d">N$T</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCF</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">AGLDB</subfield><subfield code="d">ICA</subfield><subfield code="d">D6H</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">VTS</subfield><subfield code="d">STF</subfield><subfield code="d">M8D</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">TTECH</subfield><subfield code="d">AJS</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCL</subfield><subfield code="d">OCLCQ</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038269267</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3038269263</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)916954406</subfield></datafield><datafield tag="050" ind1=" " ind2="4"><subfield code="a">TA418.9.N35</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">TEC</subfield><subfield code="x">009000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">TEC</subfield><subfield code="x">035000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="082" ind1="7" ind2=" "><subfield code="a">620.5</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">MAIN</subfield></datafield><datafield tag="111" ind1="2" ind2=" "><subfield code="a">China International Nanoscience And Technology Symposium</subfield><subfield code="n">(13th :</subfield><subfield code="d">2014 :</subfield><subfield code="c">Chengdu, China)</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Current Micro-Nano Science and Technology :</subfield><subfield code="b">Selected, Peer Reviewed Papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China /</subfield><subfield code="c">edited by Hailin Cong, Bing Yu and Xing Lu.</subfield></datafield><datafield tag="260" ind1=" " ind2=" "><subfield code="a">Zurich :</subfield><subfield code="b">Trans Tech Publishers,</subfield><subfield code="c">©2015.</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (297 pages) :</subfield><subfield code="b">illustrations (some color)</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">computer</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">online resource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Advanced Materials Research ;</subfield><subfield code="v">v. 1118</subfield></datafield><datafield tag="588" ind1="0" ind2=" "><subfield code="a">Print version record.</subfield></datafield><datafield tag="505" ind1="0" ind2=" "><subfield code="a">Current Micro-Nano Science and Technology; Preface, Committees and Sponsors; Table of Contents; Chapter 1: Synthesis and Preparation of Nanomaterials; Fabrication of Sub-Wavelength Antireflective Structures Using a Soft Roll-to-Plate Nanoimprinting Lithographic Method; One-Pot Synthesis of Environmental Friendly Ni3S2 Quantum Dots; Palladium Nanoparticles Synthesized by Bio-Templates for Suzuki Coupling Reaction; Pd/SiO2 Organic-Inorganic Hybrid Materials by Sol-Gel Method: Preparation and Thermal Stability under H2 Atmosphere.</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Preparation and Comparatively Evaluation of Phenylethyl Resorcinol-Loaded Nanocarriers : Nanoemulsions and Nanostructured Lipid Carriers; Study on the Preparation Conditions of Nano-Silver Substrate Used for SERS Determination of Thiophene; Synthesis and Characterization of In2O3 Nanobelts via Hydrothermal Route; Synthesis of CeO2-SiO2 Composite Nanoparticles by Coprecipitation Method and Dispersion Stability of their Suspension; Synthesis, Photoluminescence and Infrared Emissivity of SnO2 Nanocrystalline Thin Films; The Standard Formation Enthalpies of Spherical ZnO Nano-Particles: Size Matters.</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">The Synthesis and Property of Neutral Silicone Glass Sealant; Influence of Calcination Temperature on the Performance of TiO2 Films in Dye-Sensitized Solar Cells; Enhancement of Luminescence of YPO4:Eu3+, Yb3+ Nanophosphor Synthesized by Hydrothermal Method; Effect of Sm-Au on Silver Staining Results and it ́s UV-Vis Absorption Spectrum; Rapid, Simple and Selective Determination of 2,4,6-dinitrophenol Based on PtAg /Mesoporous SiO2 Nanocomposite Sensor with Electrochemical Detection; Fabrication and Characterization of LaOBr:Eu3+ Luminescent Nanofibers.</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Preparation and Characterization of Nanometer Gallium Nitride by Gas-Solid Reaction; Refluxing Synthesis and Characterization of ZnO Nanopowders from Different Zinc Salts; Chapter 2: Nanotechnologies and Nanomaterials: Frontiers of Application and Properties; The Structural and Optical Properties of Be-Doped GaAs Grown by MBE; The Influence of Emulsifiers on the Formation of Res-Loaded Nanostructured Lipid Carriers; Near-Infrared Reflection Spectra of Copper Nanowire Array Structures; Investigation onto Nanometer Delay Charges for Millisecond Blasting Caps.</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Investigation of Cu Species in CuBTC: Active Sites for Selective Catalytic Reduction of NO with NH3; Influence of Exposure Time on the Photosensitive Properties of Borosilicate Photosensitive Glass-Ceramics; A Theoretical Study of Nonlinear Optical Properties for Stilbene Grafted to Carbon Nanotubes; The Surface and Photoluminescence Properties of GaAs Passivated by Wet Chemical Method; The Surface Plasmon Resonance Absorption of Indium Tin Oxide Nanoparticles and its Control; 1200 Mesh Silicon Carbide Corona Protection Varnish with Epoxy/OMMT Nano-Composite Adhesive.</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">A Novel hig E Aptamer Biosensor Base on Core-Shell Fe3O4@Au Magnetic Composite Nanoparticles.</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Collection of selected, peer reviewed papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China. The 46 papers are grouped as follows:. Chapter 1: Synthesis and Preparation of Nanomaterials;. Chapter 2: Nanotechnologies and Nanomaterials: Frontiers of Application and Properties;. Chapter 3: Frontiers of Micro-Materials and Technologies, Applications Keyword: Nanomaterials, Nanofabrication, Microfabrication, MEMS, Nanotechnology, Sensors, photolithography This book is a collection of more than 40 peer-reviewed papers from the 13th China International Nanoscience and Technology Symposium held in October 2014.</subfield></datafield><datafield tag="504" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Mechatronics</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Micromechanics</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Nanostructured materials</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Nanotechnology</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Mécatronique</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Micromécanique</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Nanomatériaux</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Nanotechnologie</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING</subfield><subfield code="x">Engineering (General)</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING</subfield><subfield code="x">Reference.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Mechatronics</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Micromechanics</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Nanostructured materials</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Nanotechnology</subfield><subfield code="2">fast</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">Conference papers and proceedings</subfield><subfield code="2">fast</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Cong, Hailin,</subfield><subfield code="e">author.</subfield><subfield code="0">http://id.loc.gov/authorities/names/nb2010011208</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Yu, Bing,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Lu, Xing,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="758" ind1=" " ind2=" "><subfield code="i">has work:</subfield><subfield code="a">Current Micro-Nano Science and Technology (Text)</subfield><subfield code="1">https://id.oclc.org/worldcat/entity/E39PCGwkRqP63FwKYMwvJhWbV3</subfield><subfield code="4">https://id.oclc.org/worldcat/ontology/hasWork</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Print version:</subfield><subfield code="a">Cong, Hailin.</subfield><subfield code="t">Current Micro-Nano Science and Technology : Selected, Peer Reviewed Papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China.</subfield><subfield code="d">Zurich : Trans Tech Publishers, ©2015</subfield><subfield code="z">9783038354642</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Advanced materials research ;</subfield><subfield code="v">v. 1118.</subfield><subfield code="0">http://id.loc.gov/authorities/names/n99255722</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="l">FWS01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=1049007</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">Trans Tech Publications, Ltd</subfield><subfield code="b">TRAN</subfield><subfield code="n">10.4028/www.scientific.net/AMR.1118</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">ProQuest Ebook Central</subfield><subfield code="b">EBLB</subfield><subfield code="n">EBL2123552</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">EBSCOhost</subfield><subfield code="b">EBSC</subfield><subfield code="n">1049007</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">YBP Library Services</subfield><subfield code="b">YANK</subfield><subfield code="n">12562628</subfield></datafield><datafield tag="994" ind1=" " ind2=" "><subfield code="a">92</subfield><subfield code="b">GEBAY</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-863</subfield></datafield></record></collection> |
| genre | Conference papers and proceedings fast |
| genre_facet | Conference papers and proceedings |
| id | ZDB-4-EBA-ocn916954406 |
| illustrated | Illustrated |
| indexdate | 2024-11-27T13:26:44Z |
| institution | BVB |
| isbn | 9783038269267 3038269263 |
| language | English |
| oclc_num | 916954406 |
| open_access_boolean | |
| owner | MAIN DE-863 DE-BY-FWS |
| owner_facet | MAIN DE-863 DE-BY-FWS |
| physical | 1 online resource (297 pages) : illustrations (some color) |
| psigel | ZDB-4-EBA |
| publishDate | 2015 |
| publishDateSearch | 2015 |
| publishDateSort | 2015 |
| publisher | Trans Tech Publishers, |
| record_format | marc |
| series | Advanced materials research ; |
| series2 | Advanced Materials Research ; |
| spelling | China International Nanoscience And Technology Symposium (13th : 2014 : Chengdu, China) Current Micro-Nano Science and Technology : Selected, Peer Reviewed Papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China / edited by Hailin Cong, Bing Yu and Xing Lu. Zurich : Trans Tech Publishers, ©2015. 1 online resource (297 pages) : illustrations (some color) text txt rdacontent computer c rdamedia online resource cr rdacarrier Advanced Materials Research ; v. 1118 Print version record. Current Micro-Nano Science and Technology; Preface, Committees and Sponsors; Table of Contents; Chapter 1: Synthesis and Preparation of Nanomaterials; Fabrication of Sub-Wavelength Antireflective Structures Using a Soft Roll-to-Plate Nanoimprinting Lithographic Method; One-Pot Synthesis of Environmental Friendly Ni3S2 Quantum Dots; Palladium Nanoparticles Synthesized by Bio-Templates for Suzuki Coupling Reaction; Pd/SiO2 Organic-Inorganic Hybrid Materials by Sol-Gel Method: Preparation and Thermal Stability under H2 Atmosphere. Preparation and Comparatively Evaluation of Phenylethyl Resorcinol-Loaded Nanocarriers : Nanoemulsions and Nanostructured Lipid Carriers; Study on the Preparation Conditions of Nano-Silver Substrate Used for SERS Determination of Thiophene; Synthesis and Characterization of In2O3 Nanobelts via Hydrothermal Route; Synthesis of CeO2-SiO2 Composite Nanoparticles by Coprecipitation Method and Dispersion Stability of their Suspension; Synthesis, Photoluminescence and Infrared Emissivity of SnO2 Nanocrystalline Thin Films; The Standard Formation Enthalpies of Spherical ZnO Nano-Particles: Size Matters. The Synthesis and Property of Neutral Silicone Glass Sealant; Influence of Calcination Temperature on the Performance of TiO2 Films in Dye-Sensitized Solar Cells; Enhancement of Luminescence of YPO4:Eu3+, Yb3+ Nanophosphor Synthesized by Hydrothermal Method; Effect of Sm-Au on Silver Staining Results and it ́s UV-Vis Absorption Spectrum; Rapid, Simple and Selective Determination of 2,4,6-dinitrophenol Based on PtAg /Mesoporous SiO2 Nanocomposite Sensor with Electrochemical Detection; Fabrication and Characterization of LaOBr:Eu3+ Luminescent Nanofibers. Preparation and Characterization of Nanometer Gallium Nitride by Gas-Solid Reaction; Refluxing Synthesis and Characterization of ZnO Nanopowders from Different Zinc Salts; Chapter 2: Nanotechnologies and Nanomaterials: Frontiers of Application and Properties; The Structural and Optical Properties of Be-Doped GaAs Grown by MBE; The Influence of Emulsifiers on the Formation of Res-Loaded Nanostructured Lipid Carriers; Near-Infrared Reflection Spectra of Copper Nanowire Array Structures; Investigation onto Nanometer Delay Charges for Millisecond Blasting Caps. Investigation of Cu Species in CuBTC: Active Sites for Selective Catalytic Reduction of NO with NH3; Influence of Exposure Time on the Photosensitive Properties of Borosilicate Photosensitive Glass-Ceramics; A Theoretical Study of Nonlinear Optical Properties for Stilbene Grafted to Carbon Nanotubes; The Surface and Photoluminescence Properties of GaAs Passivated by Wet Chemical Method; The Surface Plasmon Resonance Absorption of Indium Tin Oxide Nanoparticles and its Control; 1200 Mesh Silicon Carbide Corona Protection Varnish with Epoxy/OMMT Nano-Composite Adhesive. A Novel hig E Aptamer Biosensor Base on Core-Shell Fe3O4@Au Magnetic Composite Nanoparticles. Collection of selected, peer reviewed papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China. The 46 papers are grouped as follows:. Chapter 1: Synthesis and Preparation of Nanomaterials;. Chapter 2: Nanotechnologies and Nanomaterials: Frontiers of Application and Properties;. Chapter 3: Frontiers of Micro-Materials and Technologies, Applications Keyword: Nanomaterials, Nanofabrication, Microfabrication, MEMS, Nanotechnology, Sensors, photolithography This book is a collection of more than 40 peer-reviewed papers from the 13th China International Nanoscience and Technology Symposium held in October 2014. Includes bibliographical references. Mechatronics Congresses. Micromechanics Congresses. Nanostructured materials Congresses. Nanotechnology Congresses. Mécatronique Congrès. Micromécanique Congrès. Nanomatériaux Congrès. Nanotechnologie Congrès. TECHNOLOGY & ENGINEERING Engineering (General) bisacsh TECHNOLOGY & ENGINEERING Reference. bisacsh Mechatronics fast Micromechanics fast Nanostructured materials fast Nanotechnology fast Conference papers and proceedings fast Cong, Hailin, author. http://id.loc.gov/authorities/names/nb2010011208 Yu, Bing, editor. Lu, Xing, editor. has work: Current Micro-Nano Science and Technology (Text) https://id.oclc.org/worldcat/entity/E39PCGwkRqP63FwKYMwvJhWbV3 https://id.oclc.org/worldcat/ontology/hasWork Print version: Cong, Hailin. Current Micro-Nano Science and Technology : Selected, Peer Reviewed Papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China. Zurich : Trans Tech Publishers, ©2015 9783038354642 Advanced materials research ; v. 1118. http://id.loc.gov/authorities/names/n99255722 FWS01 ZDB-4-EBA FWS_PDA_EBA https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=1049007 Volltext |
| spellingShingle | Cong, Hailin Current Micro-Nano Science and Technology : Selected, Peer Reviewed Papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China / Advanced materials research ; Current Micro-Nano Science and Technology; Preface, Committees and Sponsors; Table of Contents; Chapter 1: Synthesis and Preparation of Nanomaterials; Fabrication of Sub-Wavelength Antireflective Structures Using a Soft Roll-to-Plate Nanoimprinting Lithographic Method; One-Pot Synthesis of Environmental Friendly Ni3S2 Quantum Dots; Palladium Nanoparticles Synthesized by Bio-Templates for Suzuki Coupling Reaction; Pd/SiO2 Organic-Inorganic Hybrid Materials by Sol-Gel Method: Preparation and Thermal Stability under H2 Atmosphere. Preparation and Comparatively Evaluation of Phenylethyl Resorcinol-Loaded Nanocarriers : Nanoemulsions and Nanostructured Lipid Carriers; Study on the Preparation Conditions of Nano-Silver Substrate Used for SERS Determination of Thiophene; Synthesis and Characterization of In2O3 Nanobelts via Hydrothermal Route; Synthesis of CeO2-SiO2 Composite Nanoparticles by Coprecipitation Method and Dispersion Stability of their Suspension; Synthesis, Photoluminescence and Infrared Emissivity of SnO2 Nanocrystalline Thin Films; The Standard Formation Enthalpies of Spherical ZnO Nano-Particles: Size Matters. The Synthesis and Property of Neutral Silicone Glass Sealant; Influence of Calcination Temperature on the Performance of TiO2 Films in Dye-Sensitized Solar Cells; Enhancement of Luminescence of YPO4:Eu3+, Yb3+ Nanophosphor Synthesized by Hydrothermal Method; Effect of Sm-Au on Silver Staining Results and it ́s UV-Vis Absorption Spectrum; Rapid, Simple and Selective Determination of 2,4,6-dinitrophenol Based on PtAg /Mesoporous SiO2 Nanocomposite Sensor with Electrochemical Detection; Fabrication and Characterization of LaOBr:Eu3+ Luminescent Nanofibers. Preparation and Characterization of Nanometer Gallium Nitride by Gas-Solid Reaction; Refluxing Synthesis and Characterization of ZnO Nanopowders from Different Zinc Salts; Chapter 2: Nanotechnologies and Nanomaterials: Frontiers of Application and Properties; The Structural and Optical Properties of Be-Doped GaAs Grown by MBE; The Influence of Emulsifiers on the Formation of Res-Loaded Nanostructured Lipid Carriers; Near-Infrared Reflection Spectra of Copper Nanowire Array Structures; Investigation onto Nanometer Delay Charges for Millisecond Blasting Caps. Investigation of Cu Species in CuBTC: Active Sites for Selective Catalytic Reduction of NO with NH3; Influence of Exposure Time on the Photosensitive Properties of Borosilicate Photosensitive Glass-Ceramics; A Theoretical Study of Nonlinear Optical Properties for Stilbene Grafted to Carbon Nanotubes; The Surface and Photoluminescence Properties of GaAs Passivated by Wet Chemical Method; The Surface Plasmon Resonance Absorption of Indium Tin Oxide Nanoparticles and its Control; 1200 Mesh Silicon Carbide Corona Protection Varnish with Epoxy/OMMT Nano-Composite Adhesive. Mechatronics Congresses. Micromechanics Congresses. Nanostructured materials Congresses. Nanotechnology Congresses. Mécatronique Congrès. Micromécanique Congrès. Nanomatériaux Congrès. Nanotechnologie Congrès. TECHNOLOGY & ENGINEERING Engineering (General) bisacsh TECHNOLOGY & ENGINEERING Reference. bisacsh Mechatronics fast Micromechanics fast Nanostructured materials fast Nanotechnology fast |
| title | Current Micro-Nano Science and Technology : Selected, Peer Reviewed Papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China / |
| title_auth | Current Micro-Nano Science and Technology : Selected, Peer Reviewed Papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China / |
| title_exact_search | Current Micro-Nano Science and Technology : Selected, Peer Reviewed Papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China / |
| title_full | Current Micro-Nano Science and Technology : Selected, Peer Reviewed Papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China / edited by Hailin Cong, Bing Yu and Xing Lu. |
| title_fullStr | Current Micro-Nano Science and Technology : Selected, Peer Reviewed Papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China / edited by Hailin Cong, Bing Yu and Xing Lu. |
| title_full_unstemmed | Current Micro-Nano Science and Technology : Selected, Peer Reviewed Papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China / edited by Hailin Cong, Bing Yu and Xing Lu. |
| title_short | Current Micro-Nano Science and Technology : |
| title_sort | current micro nano science and technology selected peer reviewed papers from the 13th china international nanoscience and technology symposium october 26 30 2014 chengdu china |
| title_sub | Selected, Peer Reviewed Papers from the 13th China International Nanoscience and Technology Symposium, October 26-30, 2014, Chengdu, China / |
| topic | Mechatronics Congresses. Micromechanics Congresses. Nanostructured materials Congresses. Nanotechnology Congresses. Mécatronique Congrès. Micromécanique Congrès. Nanomatériaux Congrès. Nanotechnologie Congrès. TECHNOLOGY & ENGINEERING Engineering (General) bisacsh TECHNOLOGY & ENGINEERING Reference. bisacsh Mechatronics fast Micromechanics fast Nanostructured materials fast Nanotechnology fast |
| topic_facet | Mechatronics Congresses. Micromechanics Congresses. Nanostructured materials Congresses. Nanotechnology Congresses. Mécatronique Congrès. Micromécanique Congrès. Nanomatériaux Congrès. Nanotechnologie Congrès. TECHNOLOGY & ENGINEERING Engineering (General) TECHNOLOGY & ENGINEERING Reference. Mechatronics Micromechanics Nanostructured materials Nanotechnology Conference papers and proceedings |
| url | https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=1049007 |
| work_keys_str_mv | AT chinainternationalnanoscienceandtechnologysymposiumchengduchina currentmicronanoscienceandtechnologyselectedpeerreviewedpapersfromthe13thchinainternationalnanoscienceandtechnologysymposiumoctober26302014chengduchina AT conghailin currentmicronanoscienceandtechnologyselectedpeerreviewedpapersfromthe13thchinainternationalnanoscienceandtechnologysymposiumoctober26302014chengduchina AT yubing currentmicronanoscienceandtechnologyselectedpeerreviewedpapersfromthe13thchinainternationalnanoscienceandtechnologysymposiumoctober26302014chengduchina AT luxing currentmicronanoscienceandtechnologyselectedpeerreviewedpapersfromthe13thchinainternationalnanoscienceandtechnologysymposiumoctober26302014chengduchina |