Advanced research on structure, materials, engineering and information technology III :: selected, peer reviewed papers from the 2014 3 rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China /
Collection of selected, peer reviewed papers from the 2014 3rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China. The 53 papers are grouped as follows: Chapter 1: Material Science and Chemical Technologies, Chapter 2: Construction...
Gespeichert in:
Körperschaft: | |
---|---|
Weitere Verfasser: | , , |
Format: | Elektronisch Tagungsbericht E-Book |
Sprache: | English |
Veröffentlicht: |
Pfaffikon, Switzerland :
TTP,
2014.
|
Schriftenreihe: | Advanced materials research ;
v. 1021. |
Schlagworte: | |
Online-Zugang: | DE-862 DE-863 |
Zusammenfassung: | Collection of selected, peer reviewed papers from the 2014 3rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China. The 53 papers are grouped as follows: Chapter 1: Material Science and Chemical Technologies, Chapter 2: Construction Technologies, Building Materials and Structures, Chapter 3: Mechanical Engineering and Electrical Engineering, Chapter 4: Environment Engineering, Chapter 5: Applied Information Technologies Keyword: structure engineering, Materials Science, Energy and Environment, Mechanical Engineering, Applied Mechanics, Information System, Applied Technology The 53 papers cover material science and chemical technologies; construction technologies, building materials, and structures; mechanical engineering and electrical engineering; environmental engineering; and applied information technologies. Among the topics are prospects for China's aromatic hydrocarbon industry based on material properties, the impact on the surrounding buildings of a deep excavation in Hefei, viscous dampers to reduce seismic risk at an operating electronic facility, detecting the speed of a motor with a single-chip microcomputer and waveform recording system, applying particle mechanics to conveying machinery, and methane fermentation residue with material properties for raising pigs. -- Civil engineering-- Construction-- Materials science. |
Beschreibung: | 1 online resource (276 pages) : illustrations |
Bibliographie: | Includes bibliographical references at the end of each chapters and indexes. |
ISBN: | 9783038266310 3038266310 |
ISSN: | 1662-8985 ; 1662-8985 |
Internformat
MARC
LEADER | 00000cam a2200000 i 4500 | ||
---|---|---|---|
001 | ZDB-4-EBA-ocn893685580 | ||
003 | OCoLC | ||
005 | 20241004212047.0 | ||
006 | m o d | ||
007 | cr cn||||||||| | ||
008 | 140925t20142014sz a ob 101 0 eng d | ||
040 | |a E7B |b eng |e rda |e pn |c E7B |d OCLCO |d N$T |d CUS |d UKMGB |d EBLCP |d OCLCF |d YDXCP |d DEBSZ |d OCLCO |d OCLCQ |d OCLCO |d OCL |d OCLCO |d LLB |d OCLCQ |d AGLDB |d OCLCQ |d VTS |d STF |d M8D |d OCLCQ |d VLY |d OCLCO |d OCLCQ |d OCLCO |d OCLCL | ||
016 | 7 | |a 016957954 |2 Uk | |
019 | |a 900559580 |a 959871499 |a 963740395 |a 966476707 |a 967767756 |a 968758296 | ||
020 | |a 9783038266310 |q (electronic bk.) | ||
020 | |a 3038266310 |q (electronic bk.) | ||
020 | |z 9783038352471 | ||
020 | |z 3038352470 | ||
035 | |a (OCoLC)893685580 |z (OCoLC)900559580 |z (OCoLC)959871499 |z (OCoLC)963740395 |z (OCoLC)966476707 |z (OCoLC)967767756 |z (OCoLC)968758296 | ||
050 | 4 | |a TK7882.I6 |b .I584 2014eb | |
072 | 7 | |a TEC |x 009070 |2 bisacsh | |
082 | 7 | |a 621.3815422 |2 23 | |
049 | |a MAIN | ||
111 | 2 | |a International Conference on Advanced Structure, Materials and Engineering |n (3rd : |d 2014 : |c Wuhan, China) | |
245 | 1 | 0 | |a Advanced research on structure, materials, engineering and information technology III : |b selected, peer reviewed papers from the 2014 3 rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China / |c edited by Helen Zhang, M. Han and X.J. Zhao. |
246 | 3 | |a ASME | |
264 | 1 | |a Pfaffikon, Switzerland : |b TTP, |c 2014. | |
264 | 4 | |c ©2014 | |
300 | |a 1 online resource (276 pages) : |b illustrations | ||
336 | |a text |b txt |2 rdacontent | ||
337 | |a computer |b c |2 rdamedia | ||
338 | |a online resource |b cr |2 rdacarrier | ||
490 | 1 | |a Advanced Materials Research, |x 1662-8985 ; |v Volume 1021 | |
504 | |a Includes bibliographical references at the end of each chapters and indexes. | ||
588 | 0 | |a Online resource; title from PDF title page (ebrary, viewed September 25, 2014). | |
520 | |a Collection of selected, peer reviewed papers from the 2014 3rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China. The 53 papers are grouped as follows: Chapter 1: Material Science and Chemical Technologies, Chapter 2: Construction Technologies, Building Materials and Structures, Chapter 3: Mechanical Engineering and Electrical Engineering, Chapter 4: Environment Engineering, Chapter 5: Applied Information Technologies Keyword: structure engineering, Materials Science, Energy and Environment, Mechanical Engineering, Applied Mechanics, Information System, Applied Technology The 53 papers cover material science and chemical technologies; construction technologies, building materials, and structures; mechanical engineering and electrical engineering; environmental engineering; and applied information technologies. Among the topics are prospects for China's aromatic hydrocarbon industry based on material properties, the impact on the surrounding buildings of a deep excavation in Hefei, viscous dampers to reduce seismic risk at an operating electronic facility, detecting the speed of a motor with a single-chip microcomputer and waveform recording system, applying particle mechanics to conveying machinery, and methane fermentation residue with material properties for raising pigs. -- Civil engineering-- Construction-- Materials science. | ||
505 | 0 | |a Advanced Research on Structure, Materials, Engineering and Information Technology III; Preface, Committee and Sponsors; Table of Contents; Chapter 1: Material Science and Chemical Technologies; Preparation and Properties of Polysiloxane Modified Epoxy Encapsulating Material; Preparation and Properties of the Phase Inversion Emulsification of Epoxy Resin; Non-Asbestos Gasket Materials for Formula Design; The Heat Upsetting Process for the Titanium Alloy Spherical Bone Screws; Thickening Carbon Dioxide by Designing New Block Copolymer | |
505 | 8 | |a Effect of Adding Rare Earths into Iron-Carbon Micro Electrolysis Process on Degradation of Dyeing WastewaterRelative Ratio Method for Material Selection Problem with Interval Numbers; Research on Material Thickness and Material Properties with Application of Sensors; Corrosion Behavior of 3Cr Steel in Different Water Cut; Prospects of China's Aromatic Hydrocarbon Industry Based on Material Properties; Thermal Entanglement Entropy Signature of Spin-Peierls Transition in Dimerized Isotropic XY Chain with Multi-Spin Interactions; Dithiolate Mixed with Diimine and it's Metal Effects on Sensors | |
505 | 8 | |a Kinetics on the Leaching of Total Flavonoids from Arctium lappal RootChapter 2: Construction Technologies, Building Materials and Structures; Strengthening of RC-Brick Masonry Walls with Opening Using Basalt Fiber Reinforced Polymer; Special Strength Curve of Ultrasonic-Rebound Combined Method for Concrete of Oujiang River Bridge; Tangent Stiffness Matrix of Spatial Beam Element Considering Bend and Torsion Coupling Effect; Analysis of the Bearing and Deformation Characteristics for Large Diameter Pile; Destructive Criteria for Highway Thick Filling Area Based on Stress Path Analysis | |
505 | 8 | |a Analysis on Relationship with Pedestrian Network through Space Syntax -- Paldalmoon Market in SuwonMonitoring and Analysis of a Deep Excavation in Hefei; The Impact on the Surrounding Buildings of a Deep Excavation in Hefei; The Influence of Raft Foundation Temperature Stress Calculation by Radiation Condition; The Masonry Crack Propagation Simulation Based on LS-DYNA; Study on Threaded Connection's Strength in Gas Storage Well Using Finite Element Analysis; The Dynamic Measuring Method of Nondestructive Testing the Overall Performance of Some Frame Shear Wall Structure | |
505 | 8 | |a Finite Element Analysis of Mechanical Properties of Reinforced Concrete Cross-Shaped Column NodeExperimental Research of Recycled Tires-Asphalt Sands Base Isolation Device for Low-Raise Masonry Structure under Vibrating Load; Viscous Dampers Utilized at an Operating Electronic Facility for Reducing Seismic Risk; Compressive Characteristics with Variation of Length of Shear Connections for Steel-Plate Concrete Structures Adding Hwangtho; Evaluation of Flexural Strength about Shape of the Steel Plate-Concrete Composite Beam with Bolt | |
505 | 8 | |a Numerical Analysis of Tension-Type Stress -- Concentration Cable and Stress-Dispersed Cable | |
650 | 0 | |a Information display systems |v Congresses. | |
650 | 6 | |a Affichage (Technique) |v Congrès. | |
650 | 7 | |a TECHNOLOGY & ENGINEERING |x Mechanical. |2 bisacsh | |
650 | 7 | |a Information display systems |2 fast | |
655 | 7 | |a Conference papers and proceedings |2 fast | |
700 | 1 | |a Zhang, Helen, |e editor. | |
700 | 1 | |a Han, M., |e editor. | |
700 | 1 | |a Zhao, X. J., |e editor. | |
758 | |i has work: |a Advanced Research on Structure, Materials, Engineering and Information Technology III (Text) |1 https://id.oclc.org/worldcat/entity/E39PCXHB7v4vxmyw44h6cPHJMq |4 https://id.oclc.org/worldcat/ontology/hasWork | ||
776 | 0 | 8 | |i Print version: |a International Conference on Advanced Structure, Materials and Engineering (3rd : 2014 : Wuhan, China). |t Advanced research on structure, materials, engineering and information technology III : selected, peer reviewed papers from the 2014 3 rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China. |d Pfaffikon, Switzerland : TTP, ©2014 |h 275 pages |k Advanced materials research ; Volume 1021 |x 1662-8985 |z 9783038352471 |
830 | 0 | |a Advanced materials research ; |v v. 1021. |0 http://id.loc.gov/authorities/names/n99255722 | |
966 | 4 | 0 | |l DE-862 |p ZDB-4-EBA |q FWS_PDA_EBA |u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=842620 |3 Volltext |
966 | 4 | 0 | |l DE-863 |p ZDB-4-EBA |q FWS_PDA_EBA |u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=842620 |3 Volltext |
936 | |a BATCHLOAD | ||
938 | |a ProQuest Ebook Central |b EBLB |n EBL1910944 | ||
938 | |a ebrary |b EBRY |n ebr10930307 | ||
938 | |a EBSCOhost |b EBSC |n 842620 | ||
938 | |a YBP Library Services |b YANK |n 12065300 | ||
994 | |a 92 |b GEBAY | ||
912 | |a ZDB-4-EBA | ||
049 | |a DE-862 | ||
049 | |a DE-863 |
Datensatz im Suchindex
DE-BY-FWS_katkey | ZDB-4-EBA-ocn893685580 |
---|---|
_version_ | 1826942063311060992 |
adam_text | |
any_adam_object | |
author2 | Zhang, Helen Han, M. Zhao, X. J. |
author2_role | edt edt edt |
author2_variant | h z hz m h mh x j z xj xjz |
author_corporate | International Conference on Advanced Structure, Materials and Engineering Wuhan, China |
author_corporate_role | |
author_facet | Zhang, Helen Han, M. Zhao, X. J. International Conference on Advanced Structure, Materials and Engineering Wuhan, China |
author_sort | International Conference on Advanced Structure, Materials and Engineering Wuhan, China |
building | Verbundindex |
bvnumber | localFWS |
callnumber-first | T - Technology |
callnumber-label | TK7882 |
callnumber-raw | TK7882.I6 .I584 2014eb |
callnumber-search | TK7882.I6 .I584 2014eb |
callnumber-sort | TK 47882 I6 I584 42014EB |
callnumber-subject | TK - Electrical and Nuclear Engineering |
collection | ZDB-4-EBA |
contents | Advanced Research on Structure, Materials, Engineering and Information Technology III; Preface, Committee and Sponsors; Table of Contents; Chapter 1: Material Science and Chemical Technologies; Preparation and Properties of Polysiloxane Modified Epoxy Encapsulating Material; Preparation and Properties of the Phase Inversion Emulsification of Epoxy Resin; Non-Asbestos Gasket Materials for Formula Design; The Heat Upsetting Process for the Titanium Alloy Spherical Bone Screws; Thickening Carbon Dioxide by Designing New Block Copolymer Effect of Adding Rare Earths into Iron-Carbon Micro Electrolysis Process on Degradation of Dyeing WastewaterRelative Ratio Method for Material Selection Problem with Interval Numbers; Research on Material Thickness and Material Properties with Application of Sensors; Corrosion Behavior of 3Cr Steel in Different Water Cut; Prospects of China's Aromatic Hydrocarbon Industry Based on Material Properties; Thermal Entanglement Entropy Signature of Spin-Peierls Transition in Dimerized Isotropic XY Chain with Multi-Spin Interactions; Dithiolate Mixed with Diimine and it's Metal Effects on Sensors Kinetics on the Leaching of Total Flavonoids from Arctium lappal RootChapter 2: Construction Technologies, Building Materials and Structures; Strengthening of RC-Brick Masonry Walls with Opening Using Basalt Fiber Reinforced Polymer; Special Strength Curve of Ultrasonic-Rebound Combined Method for Concrete of Oujiang River Bridge; Tangent Stiffness Matrix of Spatial Beam Element Considering Bend and Torsion Coupling Effect; Analysis of the Bearing and Deformation Characteristics for Large Diameter Pile; Destructive Criteria for Highway Thick Filling Area Based on Stress Path Analysis Analysis on Relationship with Pedestrian Network through Space Syntax -- Paldalmoon Market in SuwonMonitoring and Analysis of a Deep Excavation in Hefei; The Impact on the Surrounding Buildings of a Deep Excavation in Hefei; The Influence of Raft Foundation Temperature Stress Calculation by Radiation Condition; The Masonry Crack Propagation Simulation Based on LS-DYNA; Study on Threaded Connection's Strength in Gas Storage Well Using Finite Element Analysis; The Dynamic Measuring Method of Nondestructive Testing the Overall Performance of Some Frame Shear Wall Structure Finite Element Analysis of Mechanical Properties of Reinforced Concrete Cross-Shaped Column NodeExperimental Research of Recycled Tires-Asphalt Sands Base Isolation Device for Low-Raise Masonry Structure under Vibrating Load; Viscous Dampers Utilized at an Operating Electronic Facility for Reducing Seismic Risk; Compressive Characteristics with Variation of Length of Shear Connections for Steel-Plate Concrete Structures Adding Hwangtho; Evaluation of Flexural Strength about Shape of the Steel Plate-Concrete Composite Beam with Bolt Numerical Analysis of Tension-Type Stress -- Concentration Cable and Stress-Dispersed Cable |
ctrlnum | (OCoLC)893685580 |
dewey-full | 621.3815422 |
dewey-hundreds | 600 - Technology (Applied sciences) |
dewey-ones | 621 - Applied physics |
dewey-raw | 621.3815422 |
dewey-search | 621.3815422 |
dewey-sort | 3621.3815422 |
dewey-tens | 620 - Engineering and allied operations |
discipline | Elektrotechnik / Elektronik / Nachrichtentechnik |
format | Electronic Conference Proceeding eBook |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>07979cam a2200685 i 4500</leader><controlfield tag="001">ZDB-4-EBA-ocn893685580</controlfield><controlfield tag="003">OCoLC</controlfield><controlfield tag="005">20241004212047.0</controlfield><controlfield tag="006">m o d </controlfield><controlfield tag="007">cr cn|||||||||</controlfield><controlfield tag="008">140925t20142014sz a ob 101 0 eng d</controlfield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">E7B</subfield><subfield code="b">eng</subfield><subfield code="e">rda</subfield><subfield code="e">pn</subfield><subfield code="c">E7B</subfield><subfield code="d">OCLCO</subfield><subfield code="d">N$T</subfield><subfield code="d">CUS</subfield><subfield code="d">UKMGB</subfield><subfield code="d">EBLCP</subfield><subfield code="d">OCLCF</subfield><subfield code="d">YDXCP</subfield><subfield code="d">DEBSZ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCL</subfield><subfield code="d">OCLCO</subfield><subfield code="d">LLB</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">AGLDB</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">VTS</subfield><subfield code="d">STF</subfield><subfield code="d">M8D</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">VLY</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCL</subfield></datafield><datafield tag="016" ind1="7" ind2=" "><subfield code="a">016957954</subfield><subfield code="2">Uk</subfield></datafield><datafield tag="019" ind1=" " ind2=" "><subfield code="a">900559580</subfield><subfield code="a">959871499</subfield><subfield code="a">963740395</subfield><subfield code="a">966476707</subfield><subfield code="a">967767756</subfield><subfield code="a">968758296</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038266310</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3038266310</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">9783038352471</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">3038352470</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)893685580</subfield><subfield code="z">(OCoLC)900559580</subfield><subfield code="z">(OCoLC)959871499</subfield><subfield code="z">(OCoLC)963740395</subfield><subfield code="z">(OCoLC)966476707</subfield><subfield code="z">(OCoLC)967767756</subfield><subfield code="z">(OCoLC)968758296</subfield></datafield><datafield tag="050" ind1=" " ind2="4"><subfield code="a">TK7882.I6</subfield><subfield code="b">.I584 2014eb</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">TEC</subfield><subfield code="x">009070</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="082" ind1="7" ind2=" "><subfield code="a">621.3815422</subfield><subfield code="2">23</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">MAIN</subfield></datafield><datafield tag="111" ind1="2" ind2=" "><subfield code="a">International Conference on Advanced Structure, Materials and Engineering</subfield><subfield code="n">(3rd :</subfield><subfield code="d">2014 :</subfield><subfield code="c">Wuhan, China)</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Advanced research on structure, materials, engineering and information technology III :</subfield><subfield code="b">selected, peer reviewed papers from the 2014 3 rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China /</subfield><subfield code="c">edited by Helen Zhang, M. Han and X.J. Zhao.</subfield></datafield><datafield tag="246" ind1="3" ind2=" "><subfield code="a">ASME</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Pfaffikon, Switzerland :</subfield><subfield code="b">TTP,</subfield><subfield code="c">2014.</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">©2014</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (276 pages) :</subfield><subfield code="b">illustrations</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">computer</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">online resource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Advanced Materials Research,</subfield><subfield code="x">1662-8985 ;</subfield><subfield code="v">Volume 1021</subfield></datafield><datafield tag="504" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references at the end of each chapters and indexes.</subfield></datafield><datafield tag="588" ind1="0" ind2=" "><subfield code="a">Online resource; title from PDF title page (ebrary, viewed September 25, 2014).</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Collection of selected, peer reviewed papers from the 2014 3rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China. The 53 papers are grouped as follows: Chapter 1: Material Science and Chemical Technologies, Chapter 2: Construction Technologies, Building Materials and Structures, Chapter 3: Mechanical Engineering and Electrical Engineering, Chapter 4: Environment Engineering, Chapter 5: Applied Information Technologies Keyword: structure engineering, Materials Science, Energy and Environment, Mechanical Engineering, Applied Mechanics, Information System, Applied Technology The 53 papers cover material science and chemical technologies; construction technologies, building materials, and structures; mechanical engineering and electrical engineering; environmental engineering; and applied information technologies. Among the topics are prospects for China's aromatic hydrocarbon industry based on material properties, the impact on the surrounding buildings of a deep excavation in Hefei, viscous dampers to reduce seismic risk at an operating electronic facility, detecting the speed of a motor with a single-chip microcomputer and waveform recording system, applying particle mechanics to conveying machinery, and methane fermentation residue with material properties for raising pigs. -- Civil engineering-- Construction-- Materials science.</subfield></datafield><datafield tag="505" ind1="0" ind2=" "><subfield code="a">Advanced Research on Structure, Materials, Engineering and Information Technology III; Preface, Committee and Sponsors; Table of Contents; Chapter 1: Material Science and Chemical Technologies; Preparation and Properties of Polysiloxane Modified Epoxy Encapsulating Material; Preparation and Properties of the Phase Inversion Emulsification of Epoxy Resin; Non-Asbestos Gasket Materials for Formula Design; The Heat Upsetting Process for the Titanium Alloy Spherical Bone Screws; Thickening Carbon Dioxide by Designing New Block Copolymer</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Effect of Adding Rare Earths into Iron-Carbon Micro Electrolysis Process on Degradation of Dyeing WastewaterRelative Ratio Method for Material Selection Problem with Interval Numbers; Research on Material Thickness and Material Properties with Application of Sensors; Corrosion Behavior of 3Cr Steel in Different Water Cut; Prospects of China's Aromatic Hydrocarbon Industry Based on Material Properties; Thermal Entanglement Entropy Signature of Spin-Peierls Transition in Dimerized Isotropic XY Chain with Multi-Spin Interactions; Dithiolate Mixed with Diimine and it's Metal Effects on Sensors</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Kinetics on the Leaching of Total Flavonoids from Arctium lappal RootChapter 2: Construction Technologies, Building Materials and Structures; Strengthening of RC-Brick Masonry Walls with Opening Using Basalt Fiber Reinforced Polymer; Special Strength Curve of Ultrasonic-Rebound Combined Method for Concrete of Oujiang River Bridge; Tangent Stiffness Matrix of Spatial Beam Element Considering Bend and Torsion Coupling Effect; Analysis of the Bearing and Deformation Characteristics for Large Diameter Pile; Destructive Criteria for Highway Thick Filling Area Based on Stress Path Analysis</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Analysis on Relationship with Pedestrian Network through Space Syntax -- Paldalmoon Market in SuwonMonitoring and Analysis of a Deep Excavation in Hefei; The Impact on the Surrounding Buildings of a Deep Excavation in Hefei; The Influence of Raft Foundation Temperature Stress Calculation by Radiation Condition; The Masonry Crack Propagation Simulation Based on LS-DYNA; Study on Threaded Connection's Strength in Gas Storage Well Using Finite Element Analysis; The Dynamic Measuring Method of Nondestructive Testing the Overall Performance of Some Frame Shear Wall Structure</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Finite Element Analysis of Mechanical Properties of Reinforced Concrete Cross-Shaped Column NodeExperimental Research of Recycled Tires-Asphalt Sands Base Isolation Device for Low-Raise Masonry Structure under Vibrating Load; Viscous Dampers Utilized at an Operating Electronic Facility for Reducing Seismic Risk; Compressive Characteristics with Variation of Length of Shear Connections for Steel-Plate Concrete Structures Adding Hwangtho; Evaluation of Flexural Strength about Shape of the Steel Plate-Concrete Composite Beam with Bolt</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Numerical Analysis of Tension-Type Stress -- Concentration Cable and Stress-Dispersed Cable</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Information display systems</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Affichage (Technique)</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING</subfield><subfield code="x">Mechanical.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Information display systems</subfield><subfield code="2">fast</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">Conference papers and proceedings</subfield><subfield code="2">fast</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Zhang, Helen,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Han, M.,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Zhao, X. J.,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="758" ind1=" " ind2=" "><subfield code="i">has work:</subfield><subfield code="a">Advanced Research on Structure, Materials, Engineering and Information Technology III (Text)</subfield><subfield code="1">https://id.oclc.org/worldcat/entity/E39PCXHB7v4vxmyw44h6cPHJMq</subfield><subfield code="4">https://id.oclc.org/worldcat/ontology/hasWork</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Print version:</subfield><subfield code="a">International Conference on Advanced Structure, Materials and Engineering (3rd : 2014 : Wuhan, China).</subfield><subfield code="t">Advanced research on structure, materials, engineering and information technology III : selected, peer reviewed papers from the 2014 3 rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China.</subfield><subfield code="d">Pfaffikon, Switzerland : TTP, ©2014</subfield><subfield code="h">275 pages</subfield><subfield code="k">Advanced materials research ; Volume 1021</subfield><subfield code="x">1662-8985</subfield><subfield code="z">9783038352471</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Advanced materials research ;</subfield><subfield code="v">v. 1021.</subfield><subfield code="0">http://id.loc.gov/authorities/names/n99255722</subfield></datafield><datafield tag="966" ind1="4" ind2="0"><subfield code="l">DE-862</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=842620</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="4" ind2="0"><subfield code="l">DE-863</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=842620</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="936" ind1=" " ind2=" "><subfield code="a">BATCHLOAD</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">ProQuest Ebook Central</subfield><subfield code="b">EBLB</subfield><subfield code="n">EBL1910944</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">ebrary</subfield><subfield code="b">EBRY</subfield><subfield code="n">ebr10930307</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">EBSCOhost</subfield><subfield code="b">EBSC</subfield><subfield code="n">842620</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">YBP Library Services</subfield><subfield code="b">YANK</subfield><subfield code="n">12065300</subfield></datafield><datafield tag="994" ind1=" " ind2=" "><subfield code="a">92</subfield><subfield code="b">GEBAY</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-862</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-863</subfield></datafield></record></collection> |
genre | Conference papers and proceedings fast |
genre_facet | Conference papers and proceedings |
id | ZDB-4-EBA-ocn893685580 |
illustrated | Illustrated |
indexdate | 2025-03-18T14:22:03Z |
institution | BVB |
isbn | 9783038266310 3038266310 |
issn | 1662-8985 ; 1662-8985 |
language | English |
oclc_num | 893685580 |
open_access_boolean | |
owner | MAIN DE-862 DE-BY-FWS DE-863 DE-BY-FWS |
owner_facet | MAIN DE-862 DE-BY-FWS DE-863 DE-BY-FWS |
physical | 1 online resource (276 pages) : illustrations |
psigel | ZDB-4-EBA FWS_PDA_EBA ZDB-4-EBA |
publishDate | 2014 |
publishDateSearch | 2014 |
publishDateSort | 2014 |
publisher | TTP, |
record_format | marc |
series | Advanced materials research ; |
series2 | Advanced Materials Research, |
spelling | International Conference on Advanced Structure, Materials and Engineering (3rd : 2014 : Wuhan, China) Advanced research on structure, materials, engineering and information technology III : selected, peer reviewed papers from the 2014 3 rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China / edited by Helen Zhang, M. Han and X.J. Zhao. ASME Pfaffikon, Switzerland : TTP, 2014. ©2014 1 online resource (276 pages) : illustrations text txt rdacontent computer c rdamedia online resource cr rdacarrier Advanced Materials Research, 1662-8985 ; Volume 1021 Includes bibliographical references at the end of each chapters and indexes. Online resource; title from PDF title page (ebrary, viewed September 25, 2014). Collection of selected, peer reviewed papers from the 2014 3rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China. The 53 papers are grouped as follows: Chapter 1: Material Science and Chemical Technologies, Chapter 2: Construction Technologies, Building Materials and Structures, Chapter 3: Mechanical Engineering and Electrical Engineering, Chapter 4: Environment Engineering, Chapter 5: Applied Information Technologies Keyword: structure engineering, Materials Science, Energy and Environment, Mechanical Engineering, Applied Mechanics, Information System, Applied Technology The 53 papers cover material science and chemical technologies; construction technologies, building materials, and structures; mechanical engineering and electrical engineering; environmental engineering; and applied information technologies. Among the topics are prospects for China's aromatic hydrocarbon industry based on material properties, the impact on the surrounding buildings of a deep excavation in Hefei, viscous dampers to reduce seismic risk at an operating electronic facility, detecting the speed of a motor with a single-chip microcomputer and waveform recording system, applying particle mechanics to conveying machinery, and methane fermentation residue with material properties for raising pigs. -- Civil engineering-- Construction-- Materials science. Advanced Research on Structure, Materials, Engineering and Information Technology III; Preface, Committee and Sponsors; Table of Contents; Chapter 1: Material Science and Chemical Technologies; Preparation and Properties of Polysiloxane Modified Epoxy Encapsulating Material; Preparation and Properties of the Phase Inversion Emulsification of Epoxy Resin; Non-Asbestos Gasket Materials for Formula Design; The Heat Upsetting Process for the Titanium Alloy Spherical Bone Screws; Thickening Carbon Dioxide by Designing New Block Copolymer Effect of Adding Rare Earths into Iron-Carbon Micro Electrolysis Process on Degradation of Dyeing WastewaterRelative Ratio Method for Material Selection Problem with Interval Numbers; Research on Material Thickness and Material Properties with Application of Sensors; Corrosion Behavior of 3Cr Steel in Different Water Cut; Prospects of China's Aromatic Hydrocarbon Industry Based on Material Properties; Thermal Entanglement Entropy Signature of Spin-Peierls Transition in Dimerized Isotropic XY Chain with Multi-Spin Interactions; Dithiolate Mixed with Diimine and it's Metal Effects on Sensors Kinetics on the Leaching of Total Flavonoids from Arctium lappal RootChapter 2: Construction Technologies, Building Materials and Structures; Strengthening of RC-Brick Masonry Walls with Opening Using Basalt Fiber Reinforced Polymer; Special Strength Curve of Ultrasonic-Rebound Combined Method for Concrete of Oujiang River Bridge; Tangent Stiffness Matrix of Spatial Beam Element Considering Bend and Torsion Coupling Effect; Analysis of the Bearing and Deformation Characteristics for Large Diameter Pile; Destructive Criteria for Highway Thick Filling Area Based on Stress Path Analysis Analysis on Relationship with Pedestrian Network through Space Syntax -- Paldalmoon Market in SuwonMonitoring and Analysis of a Deep Excavation in Hefei; The Impact on the Surrounding Buildings of a Deep Excavation in Hefei; The Influence of Raft Foundation Temperature Stress Calculation by Radiation Condition; The Masonry Crack Propagation Simulation Based on LS-DYNA; Study on Threaded Connection's Strength in Gas Storage Well Using Finite Element Analysis; The Dynamic Measuring Method of Nondestructive Testing the Overall Performance of Some Frame Shear Wall Structure Finite Element Analysis of Mechanical Properties of Reinforced Concrete Cross-Shaped Column NodeExperimental Research of Recycled Tires-Asphalt Sands Base Isolation Device for Low-Raise Masonry Structure under Vibrating Load; Viscous Dampers Utilized at an Operating Electronic Facility for Reducing Seismic Risk; Compressive Characteristics with Variation of Length of Shear Connections for Steel-Plate Concrete Structures Adding Hwangtho; Evaluation of Flexural Strength about Shape of the Steel Plate-Concrete Composite Beam with Bolt Numerical Analysis of Tension-Type Stress -- Concentration Cable and Stress-Dispersed Cable Information display systems Congresses. Affichage (Technique) Congrès. TECHNOLOGY & ENGINEERING Mechanical. bisacsh Information display systems fast Conference papers and proceedings fast Zhang, Helen, editor. Han, M., editor. Zhao, X. J., editor. has work: Advanced Research on Structure, Materials, Engineering and Information Technology III (Text) https://id.oclc.org/worldcat/entity/E39PCXHB7v4vxmyw44h6cPHJMq https://id.oclc.org/worldcat/ontology/hasWork Print version: International Conference on Advanced Structure, Materials and Engineering (3rd : 2014 : Wuhan, China). Advanced research on structure, materials, engineering and information technology III : selected, peer reviewed papers from the 2014 3 rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China. Pfaffikon, Switzerland : TTP, ©2014 275 pages Advanced materials research ; Volume 1021 1662-8985 9783038352471 Advanced materials research ; v. 1021. http://id.loc.gov/authorities/names/n99255722 |
spellingShingle | Advanced research on structure, materials, engineering and information technology III : selected, peer reviewed papers from the 2014 3 rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China / Advanced materials research ; Advanced Research on Structure, Materials, Engineering and Information Technology III; Preface, Committee and Sponsors; Table of Contents; Chapter 1: Material Science and Chemical Technologies; Preparation and Properties of Polysiloxane Modified Epoxy Encapsulating Material; Preparation and Properties of the Phase Inversion Emulsification of Epoxy Resin; Non-Asbestos Gasket Materials for Formula Design; The Heat Upsetting Process for the Titanium Alloy Spherical Bone Screws; Thickening Carbon Dioxide by Designing New Block Copolymer Effect of Adding Rare Earths into Iron-Carbon Micro Electrolysis Process on Degradation of Dyeing WastewaterRelative Ratio Method for Material Selection Problem with Interval Numbers; Research on Material Thickness and Material Properties with Application of Sensors; Corrosion Behavior of 3Cr Steel in Different Water Cut; Prospects of China's Aromatic Hydrocarbon Industry Based on Material Properties; Thermal Entanglement Entropy Signature of Spin-Peierls Transition in Dimerized Isotropic XY Chain with Multi-Spin Interactions; Dithiolate Mixed with Diimine and it's Metal Effects on Sensors Kinetics on the Leaching of Total Flavonoids from Arctium lappal RootChapter 2: Construction Technologies, Building Materials and Structures; Strengthening of RC-Brick Masonry Walls with Opening Using Basalt Fiber Reinforced Polymer; Special Strength Curve of Ultrasonic-Rebound Combined Method for Concrete of Oujiang River Bridge; Tangent Stiffness Matrix of Spatial Beam Element Considering Bend and Torsion Coupling Effect; Analysis of the Bearing and Deformation Characteristics for Large Diameter Pile; Destructive Criteria for Highway Thick Filling Area Based on Stress Path Analysis Analysis on Relationship with Pedestrian Network through Space Syntax -- Paldalmoon Market in SuwonMonitoring and Analysis of a Deep Excavation in Hefei; The Impact on the Surrounding Buildings of a Deep Excavation in Hefei; The Influence of Raft Foundation Temperature Stress Calculation by Radiation Condition; The Masonry Crack Propagation Simulation Based on LS-DYNA; Study on Threaded Connection's Strength in Gas Storage Well Using Finite Element Analysis; The Dynamic Measuring Method of Nondestructive Testing the Overall Performance of Some Frame Shear Wall Structure Finite Element Analysis of Mechanical Properties of Reinforced Concrete Cross-Shaped Column NodeExperimental Research of Recycled Tires-Asphalt Sands Base Isolation Device for Low-Raise Masonry Structure under Vibrating Load; Viscous Dampers Utilized at an Operating Electronic Facility for Reducing Seismic Risk; Compressive Characteristics with Variation of Length of Shear Connections for Steel-Plate Concrete Structures Adding Hwangtho; Evaluation of Flexural Strength about Shape of the Steel Plate-Concrete Composite Beam with Bolt Numerical Analysis of Tension-Type Stress -- Concentration Cable and Stress-Dispersed Cable Information display systems Congresses. Affichage (Technique) Congrès. TECHNOLOGY & ENGINEERING Mechanical. bisacsh Information display systems fast |
title | Advanced research on structure, materials, engineering and information technology III : selected, peer reviewed papers from the 2014 3 rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China / |
title_alt | ASME |
title_auth | Advanced research on structure, materials, engineering and information technology III : selected, peer reviewed papers from the 2014 3 rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China / |
title_exact_search | Advanced research on structure, materials, engineering and information technology III : selected, peer reviewed papers from the 2014 3 rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China / |
title_full | Advanced research on structure, materials, engineering and information technology III : selected, peer reviewed papers from the 2014 3 rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China / edited by Helen Zhang, M. Han and X.J. Zhao. |
title_fullStr | Advanced research on structure, materials, engineering and information technology III : selected, peer reviewed papers from the 2014 3 rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China / edited by Helen Zhang, M. Han and X.J. Zhao. |
title_full_unstemmed | Advanced research on structure, materials, engineering and information technology III : selected, peer reviewed papers from the 2014 3 rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China / edited by Helen Zhang, M. Han and X.J. Zhao. |
title_short | Advanced research on structure, materials, engineering and information technology III : |
title_sort | advanced research on structure materials engineering and information technology iii selected peer reviewed papers from the 2014 3 rd international conference on advanced structure materials and engineering asme 2014 august 23 24 2014 wuhan china |
title_sub | selected, peer reviewed papers from the 2014 3 rd International Conference on Advanced Structure, Materials and Engineering (ASME 2014), August 23-24, 2014, Wuhan, China / |
topic | Information display systems Congresses. Affichage (Technique) Congrès. TECHNOLOGY & ENGINEERING Mechanical. bisacsh Information display systems fast |
topic_facet | Information display systems Congresses. Affichage (Technique) Congrès. TECHNOLOGY & ENGINEERING Mechanical. Information display systems Conference papers and proceedings |
work_keys_str_mv | AT internationalconferenceonadvancedstructurematerialsandengineeringwuhanchina advancedresearchonstructurematerialsengineeringandinformationtechnologyiiiselectedpeerreviewedpapersfromthe20143rdinternationalconferenceonadvancedstructurematerialsandengineeringasme2014august23242014wuhanchina AT zhanghelen advancedresearchonstructurematerialsengineeringandinformationtechnologyiiiselectedpeerreviewedpapersfromthe20143rdinternationalconferenceonadvancedstructurematerialsandengineeringasme2014august23242014wuhanchina AT hanm advancedresearchonstructurematerialsengineeringandinformationtechnologyiiiselectedpeerreviewedpapersfromthe20143rdinternationalconferenceonadvancedstructurematerialsandengineeringasme2014august23242014wuhanchina AT zhaoxj advancedresearchonstructurematerialsengineeringandinformationtechnologyiiiselectedpeerreviewedpapersfromthe20143rdinternationalconferenceonadvancedstructurematerialsandengineeringasme2014august23242014wuhanchina AT internationalconferenceonadvancedstructurematerialsandengineeringwuhanchina asme AT zhanghelen asme AT hanm asme AT zhaoxj asme |