Materials science, computer and information technology :: selected, peer reviewed papers from the 2014 4th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China /
Collection of selected, peer reviewed papers from the 2014 4th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China. The 1292 papers are grouped as follows: Chapter 1: Advanced Materials Science, Chemical Engineering and Processing Te...
Gespeichert in:
| Körperschaft: | |
|---|---|
| Weitere Verfasser: | |
| Format: | Elektronisch Tagungsbericht E-Book |
| Sprache: | English |
| Veröffentlicht: |
Switzerland :
Trans Tech Publications,
[2014]
|
| Schriftenreihe: | Advanced materials research ;
v. 989-994. |
| Schlagworte: | |
| Online-Zugang: | Volltext |
| Zusammenfassung: | Collection of selected, peer reviewed papers from the 2014 4th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China. The 1292 papers are grouped as follows: Chapter 1: Advanced Materials Science, Chemical Engineering and Processing Technologies, Chapter 2: Applied Mechanics, Construction and Testing Technologies, Chapter 3: Bio- and Medicine Research, Chapter 4: Resource, Energy and Electronic Development, Environmental Engineering, Chapter 5: Advanced Technologies in Modelling, Simulation and Optimization, Computation Methods and Algorithms, Intelligent Engineering Applications, Chapter 6: Advanced Technologies in Mechanical Engineering, Mechatronics, Automation, Measuremant, Control and Manufacturing Technology, Chapter 7: Communication, Signal and Image Processing, Data Acquisition and Recognation Technologies, Chapter 8: General Principles of Information Technology, WEB and Networks Engineering, Information Security, E-Engineering, Software Application and Development, Chapter 9: Advanced Information and Innovative Technologies for Management, Logistics, Economics, Education, Assessment Keyword: advanced materials, construction technology, applied mechanics, energy and electronics, Environmental Engineering, Intelligent Engineering, Mechatronics, Data Acquisition, signal processing, WEB, E-engineering More than 1,200 papers cover advanced materials science, chemical engineering and processing technologies; applied mechanics, construction, and testing technologies; biological and medical research; resource, energy, and electronic development and environmental engineering; advanced technologies in modeling, simulation, and optimization; computation methods and algorithms and intelligent engineering applications; advanced technologies in mechanical engineering, mechatronics, automation, measurements, control, and manufacturing technology; communication, signal and image processing, and data acquisition and recognition technologies; general principles of information technology, web and networks engineering, information security, electronic engineering, and software application and development; and advanced information and innovation technologies for management, logistics, economics, education, and assessment. -- Computer science-- Information science-- Materials science-- Technology management. |
| Beschreibung: | 1 online resource (5758 pages) : illustrations (some color) |
| Bibliographie: | Includes bibliographical references and indexes. |
| ISBN: | 9783038265566 303826556X |
| ISSN: | 1022-6680 ; 1022-6680 |
Internformat
MARC
| LEADER | 00000cam a2200000 i 4500 | ||
|---|---|---|---|
| 001 | ZDB-4-EBA-ocn891381091 | ||
| 003 | OCoLC | ||
| 005 | 20241004212047.0 | ||
| 006 | m o d | ||
| 007 | cr cn||||||||| | ||
| 008 | 140819t20142014sz a ob 101 0 eng d | ||
| 040 | |a E7B |b eng |e rda |e pn |c E7B |d OCLCO |d CUS |d N$T |d YDXCP |d EBLCP |d OCLCF |d DEBSZ |d OCLCO |d OCL |d OCLCO |d AGLDB |d OCLCQ |d VTS |d STF |d LLB |d OCLCQ |d TTECH |d VLY |d AJS |d OCLCO |d OCLCQ |d OCLCO |d OCLCL | ||
| 019 | |a 927293175 |a 961511632 | ||
| 020 | |a 9783038265566 |q (electronic bk.) | ||
| 020 | |a 303826556X |q (electronic bk.) | ||
| 020 | |z 9783038351733 | ||
| 035 | |a (OCoLC)891381091 |z (OCoLC)927293175 |z (OCoLC)961511632 | ||
| 050 | 4 | |a QA75.5 |b .M38 2014eb | |
| 072 | 7 | |a COM |x 013000 |2 bisacsh | |
| 072 | 7 | |a COM |x 014000 |2 bisacsh | |
| 072 | 7 | |a COM |x 018000 |2 bisacsh | |
| 072 | 7 | |a COM |x 067000 |2 bisacsh | |
| 072 | 7 | |a COM |x 032000 |2 bisacsh | |
| 072 | 7 | |a COM |x 037000 |2 bisacsh | |
| 072 | 7 | |a COM |x 052000 |2 bisacsh | |
| 082 | 7 | |a 004 |2 23 | |
| 049 | |a MAIN | ||
| 111 | 2 | |a International Conference on Materials Science and Information Technology |n (4th : |d 2014 : |c Tianjin, China) | |
| 245 | 1 | 0 | |a Materials science, computer and information technology : |b selected, peer reviewed papers from the 2014 4th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China / |c edited by S.Z. Cai [and four others]. |
| 264 | 1 | |a Switzerland : |b Trans Tech Publications, |c [2014] | |
| 264 | 4 | |c ©2014 | |
| 300 | |a 1 online resource (5758 pages) : |b illustrations (some color) | ||
| 336 | |a text |b txt |2 rdacontent | ||
| 337 | |a computer |b c |2 rdamedia | ||
| 338 | |a online resource |b cr |2 rdacarrier | ||
| 490 | 1 | |a Advanced Materials Research, |x 1022-6680 ; |v Volumes 989-994 | |
| 504 | |a Includes bibliographical references and indexes. | ||
| 588 | 0 | |a Online resource; title from PDF title page (ebrary, viewed August 19, 2014). | |
| 520 | |a Collection of selected, peer reviewed papers from the 2014 4th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China. The 1292 papers are grouped as follows: Chapter 1: Advanced Materials Science, Chemical Engineering and Processing Technologies, Chapter 2: Applied Mechanics, Construction and Testing Technologies, Chapter 3: Bio- and Medicine Research, Chapter 4: Resource, Energy and Electronic Development, Environmental Engineering, Chapter 5: Advanced Technologies in Modelling, Simulation and Optimization, Computation Methods and Algorithms, Intelligent Engineering Applications, Chapter 6: Advanced Technologies in Mechanical Engineering, Mechatronics, Automation, Measuremant, Control and Manufacturing Technology, Chapter 7: Communication, Signal and Image Processing, Data Acquisition and Recognation Technologies, Chapter 8: General Principles of Information Technology, WEB and Networks Engineering, Information Security, E-Engineering, Software Application and Development, Chapter 9: Advanced Information and Innovative Technologies for Management, Logistics, Economics, Education, Assessment Keyword: advanced materials, construction technology, applied mechanics, energy and electronics, Environmental Engineering, Intelligent Engineering, Mechatronics, Data Acquisition, signal processing, WEB, E-engineering More than 1,200 papers cover advanced materials science, chemical engineering and processing technologies; applied mechanics, construction, and testing technologies; biological and medical research; resource, energy, and electronic development and environmental engineering; advanced technologies in modeling, simulation, and optimization; computation methods and algorithms and intelligent engineering applications; advanced technologies in mechanical engineering, mechatronics, automation, measurements, control, and manufacturing technology; communication, signal and image processing, and data acquisition and recognition technologies; general principles of information technology, web and networks engineering, information security, electronic engineering, and software application and development; and advanced information and innovation technologies for management, logistics, economics, education, and assessment. -- Computer science-- Information science-- Materials science-- Technology management. | ||
| 505 | 0 | |a Materials Science, Computer and Information Technology; Preface; Table of Contents; Chapter 1: Advanced Materials Science, Chemical Engineering and Processing Technologies; High Value Added Utilization of Vanadium Slag; Preparation of Zeolite 4A Using Laterite Nickel Slag and the Characteristic Study of CO2/N2 Separation; Bi2S3 Nanoflowers Synthesized via Hydrothermal Method; Study of Oxidation Degradation Eosin by Ferrate; The Relationship between Calcium Hydroxide Concentration in Pore Solution and the Strength of Stabilized Soils; Development and Application of the Screw Separator | |
| 505 | 8 | |a On Laser Shock Processing to Improve Hot Corrosion Resistance of In718 SuperalloyExtraction and Purification of Fluorene from Wash Oil; Microwave Hydrothermal Synthesis and Characterization of In2O3 Nanocrystalline; Synthesis of High-Strength and Water-Resistant Phosphogypsum Small Hollow Block; Study on Laser Micro Shock Effect on Electrical Resistivity of Nanometer Copper Film; Effect of Process Parameters on Residual Stress Distribution during Direct Laser Metal Deposition Shaping; Plasma-Induced Degradation of Benzene in Aqueous Solution | |
| 505 | 8 | |a Liquid Phase Rhodamine Boxidation Induced by Plasma with Glow Discharge ElectrolysisThe Preparation of ZnO: Al Thin Films on Flexible Substrates by Magnetron Sputtering Method; Analysis Analysis and Suggestions on Device Clamp Screw Fracture of 110kV Transmission Line; Ply Thickness' Effect on Composite Laminate under Low-Velocity Impact; Study on the Synthesis of Ethylene Glycol by Catalytic Hydrolyze of Ethylene Carbonate; Efficient Synthesis 2,3-Dihydroquinazolin-4(1H)-Ones Using Coconut Shell Char Sulfonic Acid as a Reusable Catalyst in Ethanol | |
| 505 | 8 | |a Study on the Urea Demand Model of SCR Control TechnologyEffect of Sodium Methylacrysulfonate upon the Molecular Weight and Performance of Polycarboxylate Superplasticizer; Influence of the pH Value on the Water-Reducing Performance of Polycarboxylate-Based Superplasticizers at Room Temperature; Preparation and In Vitro Release Behaviors of Paclitaxel-Loaded Pluronic F87/Poly(Lactic Acid) Nanoparticle; Application of High-Efficiency Reverse Osmosis Technology in Reclaimed Water Treatment in Power Plants; Measurement of Ultra Low Sulfur in IN718 by Using Infrared Absorption Method | |
| 505 | 8 | |a The Synthesis and Characterization of Polyphenylene Vinylene (PPV) Derivatives with Alkoxy Branched ChainsComparison and Characterization of Two Preparation Methods of Graphene Oxide; Detection of Phase Purity of Sr2FeMoO6 by Raman Spectroscopy; A Novel Environment Friendly Material: Sucrose Char Sulfonic Acid Catalyzed Three-Component Mannich Reaction; Investigation of Sewage Sludge Anaerobic Digestion Performance Using Peracetic Acid as a Pretreatment; Synthesis and Characterization of Sulfonated Poly(Arylene Ether Sulfone) Multiblock Copolymers for Proton Exchange Membrane | |
| 650 | 0 | |a Computer science |v Congresses. | |
| 650 | 0 | |a Information technology |v Congresses. | |
| 650 | 6 | |a Informatique |v Congrès. | |
| 650 | 6 | |a Technologie de l'information |v Congrès. | |
| 650 | 7 | |a COMPUTERS |x Computer Literacy. |2 bisacsh | |
| 650 | 7 | |a COMPUTERS |x Computer Science. |2 bisacsh | |
| 650 | 7 | |a COMPUTERS |x Data Processing. |2 bisacsh | |
| 650 | 7 | |a COMPUTERS |x Hardware |x General. |2 bisacsh | |
| 650 | 7 | |a COMPUTERS |x Information Technology. |2 bisacsh | |
| 650 | 7 | |a COMPUTERS |x Machine Theory. |2 bisacsh | |
| 650 | 7 | |a COMPUTERS |x Reference. |2 bisacsh | |
| 650 | 7 | |a Computer science |2 fast | |
| 650 | 7 | |a Information technology |2 fast | |
| 655 | 7 | |a Conference papers and proceedings |2 fast | |
| 700 | 1 | |a Cai, S. Z., |e editor. | |
| 758 | |i has work: |a Materials Science, Computer and Information Technology (Text) |1 https://id.oclc.org/worldcat/entity/E39PCXHgXVw6rWmmhy9BY3X8G3 |4 https://id.oclc.org/worldcat/ontology/hasWork | ||
| 776 | 0 | 8 | |i Print version: |t Materials science, computer and information technology : selected, peer reviewed papers from the 2014 4 th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China. |d Switzerland : Trans Tech Publications, ©2014 |h bbb, 57123 pages |k Advanced materials research ; Volumes 989-994 |x 1022-6680 |z 9783038351733 |
| 830 | 0 | |a Advanced materials research ; |v v. 989-994. |0 http://id.loc.gov/authorities/names/n99255722 | |
| 856 | 4 | 0 | |l FWS01 |p ZDB-4-EBA |q FWS_PDA_EBA |u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=826478 |3 Volltext |
| 938 | |a ProQuest Ebook Central |b EBLB |n EBL1910870 | ||
| 938 | |a ebrary |b EBRY |n ebr10906076 | ||
| 938 | |a EBSCOhost |b EBSC |n 826478 | ||
| 938 | |a Trans Tech Publications, Ltd |b TRAN |n 10.4028/www.scientific.net/AMR.989-994 | ||
| 938 | |a YBP Library Services |b YANK |n 12016250 | ||
| 994 | |a 92 |b GEBAY | ||
| 912 | |a ZDB-4-EBA | ||
| 049 | |a DE-863 | ||
Datensatz im Suchindex
| DE-BY-FWS_katkey | ZDB-4-EBA-ocn891381091 |
|---|---|
| _version_ | 1816882287539650560 |
| adam_text | |
| any_adam_object | |
| author2 | Cai, S. Z. |
| author2_role | edt |
| author2_variant | s z c sz szc |
| author_corporate | International Conference on Materials Science and Information Technology Tianjin, China |
| author_corporate_role | |
| author_facet | Cai, S. Z. International Conference on Materials Science and Information Technology Tianjin, China |
| author_sort | International Conference on Materials Science and Information Technology Tianjin, China |
| building | Verbundindex |
| bvnumber | localFWS |
| callnumber-first | Q - Science |
| callnumber-label | QA75 |
| callnumber-raw | QA75.5 .M38 2014eb |
| callnumber-search | QA75.5 .M38 2014eb |
| callnumber-sort | QA 275.5 M38 42014EB |
| callnumber-subject | QA - Mathematics |
| collection | ZDB-4-EBA |
| contents | Materials Science, Computer and Information Technology; Preface; Table of Contents; Chapter 1: Advanced Materials Science, Chemical Engineering and Processing Technologies; High Value Added Utilization of Vanadium Slag; Preparation of Zeolite 4A Using Laterite Nickel Slag and the Characteristic Study of CO2/N2 Separation; Bi2S3 Nanoflowers Synthesized via Hydrothermal Method; Study of Oxidation Degradation Eosin by Ferrate; The Relationship between Calcium Hydroxide Concentration in Pore Solution and the Strength of Stabilized Soils; Development and Application of the Screw Separator On Laser Shock Processing to Improve Hot Corrosion Resistance of In718 SuperalloyExtraction and Purification of Fluorene from Wash Oil; Microwave Hydrothermal Synthesis and Characterization of In2O3 Nanocrystalline; Synthesis of High-Strength and Water-Resistant Phosphogypsum Small Hollow Block; Study on Laser Micro Shock Effect on Electrical Resistivity of Nanometer Copper Film; Effect of Process Parameters on Residual Stress Distribution during Direct Laser Metal Deposition Shaping; Plasma-Induced Degradation of Benzene in Aqueous Solution Liquid Phase Rhodamine Boxidation Induced by Plasma with Glow Discharge ElectrolysisThe Preparation of ZnO: Al Thin Films on Flexible Substrates by Magnetron Sputtering Method; Analysis Analysis and Suggestions on Device Clamp Screw Fracture of 110kV Transmission Line; Ply Thickness' Effect on Composite Laminate under Low-Velocity Impact; Study on the Synthesis of Ethylene Glycol by Catalytic Hydrolyze of Ethylene Carbonate; Efficient Synthesis 2,3-Dihydroquinazolin-4(1H)-Ones Using Coconut Shell Char Sulfonic Acid as a Reusable Catalyst in Ethanol Study on the Urea Demand Model of SCR Control TechnologyEffect of Sodium Methylacrysulfonate upon the Molecular Weight and Performance of Polycarboxylate Superplasticizer; Influence of the pH Value on the Water-Reducing Performance of Polycarboxylate-Based Superplasticizers at Room Temperature; Preparation and In Vitro Release Behaviors of Paclitaxel-Loaded Pluronic F87/Poly(Lactic Acid) Nanoparticle; Application of High-Efficiency Reverse Osmosis Technology in Reclaimed Water Treatment in Power Plants; Measurement of Ultra Low Sulfur in IN718 by Using Infrared Absorption Method The Synthesis and Characterization of Polyphenylene Vinylene (PPV) Derivatives with Alkoxy Branched ChainsComparison and Characterization of Two Preparation Methods of Graphene Oxide; Detection of Phase Purity of Sr2FeMoO6 by Raman Spectroscopy; A Novel Environment Friendly Material: Sucrose Char Sulfonic Acid Catalyzed Three-Component Mannich Reaction; Investigation of Sewage Sludge Anaerobic Digestion Performance Using Peracetic Acid as a Pretreatment; Synthesis and Characterization of Sulfonated Poly(Arylene Ether Sulfone) Multiblock Copolymers for Proton Exchange Membrane |
| ctrlnum | (OCoLC)891381091 |
| dewey-full | 004 |
| dewey-hundreds | 000 - Computer science, information, general works |
| dewey-ones | 004 - Computer science |
| dewey-raw | 004 |
| dewey-search | 004 |
| dewey-sort | 14 |
| dewey-tens | 000 - Computer science, information, general works |
| discipline | Informatik |
| format | Electronic Conference Proceeding eBook |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>09108cam a2200793 i 4500</leader><controlfield tag="001">ZDB-4-EBA-ocn891381091</controlfield><controlfield tag="003">OCoLC</controlfield><controlfield tag="005">20241004212047.0</controlfield><controlfield tag="006">m o d </controlfield><controlfield tag="007">cr cn|||||||||</controlfield><controlfield tag="008">140819t20142014sz a ob 101 0 eng d</controlfield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">E7B</subfield><subfield code="b">eng</subfield><subfield code="e">rda</subfield><subfield code="e">pn</subfield><subfield code="c">E7B</subfield><subfield code="d">OCLCO</subfield><subfield code="d">CUS</subfield><subfield code="d">N$T</subfield><subfield code="d">YDXCP</subfield><subfield code="d">EBLCP</subfield><subfield code="d">OCLCF</subfield><subfield code="d">DEBSZ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCL</subfield><subfield code="d">OCLCO</subfield><subfield code="d">AGLDB</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">VTS</subfield><subfield code="d">STF</subfield><subfield code="d">LLB</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">TTECH</subfield><subfield code="d">VLY</subfield><subfield code="d">AJS</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCL</subfield></datafield><datafield tag="019" ind1=" " ind2=" "><subfield code="a">927293175</subfield><subfield code="a">961511632</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038265566</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">303826556X</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">9783038351733</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)891381091</subfield><subfield code="z">(OCoLC)927293175</subfield><subfield code="z">(OCoLC)961511632</subfield></datafield><datafield tag="050" ind1=" " ind2="4"><subfield code="a">QA75.5</subfield><subfield code="b">.M38 2014eb</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">COM</subfield><subfield code="x">013000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">COM</subfield><subfield code="x">014000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">COM</subfield><subfield code="x">018000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">COM</subfield><subfield code="x">067000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">COM</subfield><subfield code="x">032000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">COM</subfield><subfield code="x">037000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">COM</subfield><subfield code="x">052000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="082" ind1="7" ind2=" "><subfield code="a">004</subfield><subfield code="2">23</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">MAIN</subfield></datafield><datafield tag="111" ind1="2" ind2=" "><subfield code="a">International Conference on Materials Science and Information Technology</subfield><subfield code="n">(4th :</subfield><subfield code="d">2014 :</subfield><subfield code="c">Tianjin, China)</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Materials science, computer and information technology :</subfield><subfield code="b">selected, peer reviewed papers from the 2014 4th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China /</subfield><subfield code="c">edited by S.Z. Cai [and four others].</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Switzerland :</subfield><subfield code="b">Trans Tech Publications,</subfield><subfield code="c">[2014]</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">©2014</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (5758 pages) :</subfield><subfield code="b">illustrations (some color)</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">computer</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">online resource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Advanced Materials Research,</subfield><subfield code="x">1022-6680 ;</subfield><subfield code="v">Volumes 989-994</subfield></datafield><datafield tag="504" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references and indexes.</subfield></datafield><datafield tag="588" ind1="0" ind2=" "><subfield code="a">Online resource; title from PDF title page (ebrary, viewed August 19, 2014).</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Collection of selected, peer reviewed papers from the 2014 4th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China. The 1292 papers are grouped as follows: Chapter 1: Advanced Materials Science, Chemical Engineering and Processing Technologies, Chapter 2: Applied Mechanics, Construction and Testing Technologies, Chapter 3: Bio- and Medicine Research, Chapter 4: Resource, Energy and Electronic Development, Environmental Engineering, Chapter 5: Advanced Technologies in Modelling, Simulation and Optimization, Computation Methods and Algorithms, Intelligent Engineering Applications, Chapter 6: Advanced Technologies in Mechanical Engineering, Mechatronics, Automation, Measuremant, Control and Manufacturing Technology, Chapter 7: Communication, Signal and Image Processing, Data Acquisition and Recognation Technologies, Chapter 8: General Principles of Information Technology, WEB and Networks Engineering, Information Security, E-Engineering, Software Application and Development, Chapter 9: Advanced Information and Innovative Technologies for Management, Logistics, Economics, Education, Assessment Keyword: advanced materials, construction technology, applied mechanics, energy and electronics, Environmental Engineering, Intelligent Engineering, Mechatronics, Data Acquisition, signal processing, WEB, E-engineering More than 1,200 papers cover advanced materials science, chemical engineering and processing technologies; applied mechanics, construction, and testing technologies; biological and medical research; resource, energy, and electronic development and environmental engineering; advanced technologies in modeling, simulation, and optimization; computation methods and algorithms and intelligent engineering applications; advanced technologies in mechanical engineering, mechatronics, automation, measurements, control, and manufacturing technology; communication, signal and image processing, and data acquisition and recognition technologies; general principles of information technology, web and networks engineering, information security, electronic engineering, and software application and development; and advanced information and innovation technologies for management, logistics, economics, education, and assessment. -- Computer science-- Information science-- Materials science-- Technology management.</subfield></datafield><datafield tag="505" ind1="0" ind2=" "><subfield code="a">Materials Science, Computer and Information Technology; Preface; Table of Contents; Chapter 1: Advanced Materials Science, Chemical Engineering and Processing Technologies; High Value Added Utilization of Vanadium Slag; Preparation of Zeolite 4A Using Laterite Nickel Slag and the Characteristic Study of CO2/N2 Separation; Bi2S3 Nanoflowers Synthesized via Hydrothermal Method; Study of Oxidation Degradation Eosin by Ferrate; The Relationship between Calcium Hydroxide Concentration in Pore Solution and the Strength of Stabilized Soils; Development and Application of the Screw Separator</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">On Laser Shock Processing to Improve Hot Corrosion Resistance of In718 SuperalloyExtraction and Purification of Fluorene from Wash Oil; Microwave Hydrothermal Synthesis and Characterization of In2O3 Nanocrystalline; Synthesis of High-Strength and Water-Resistant Phosphogypsum Small Hollow Block; Study on Laser Micro Shock Effect on Electrical Resistivity of Nanometer Copper Film; Effect of Process Parameters on Residual Stress Distribution during Direct Laser Metal Deposition Shaping; Plasma-Induced Degradation of Benzene in Aqueous Solution</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Liquid Phase Rhodamine Boxidation Induced by Plasma with Glow Discharge ElectrolysisThe Preparation of ZnO: Al Thin Films on Flexible Substrates by Magnetron Sputtering Method; Analysis Analysis and Suggestions on Device Clamp Screw Fracture of 110kV Transmission Line; Ply Thickness' Effect on Composite Laminate under Low-Velocity Impact; Study on the Synthesis of Ethylene Glycol by Catalytic Hydrolyze of Ethylene Carbonate; Efficient Synthesis 2,3-Dihydroquinazolin-4(1H)-Ones Using Coconut Shell Char Sulfonic Acid as a Reusable Catalyst in Ethanol</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Study on the Urea Demand Model of SCR Control TechnologyEffect of Sodium Methylacrysulfonate upon the Molecular Weight and Performance of Polycarboxylate Superplasticizer; Influence of the pH Value on the Water-Reducing Performance of Polycarboxylate-Based Superplasticizers at Room Temperature; Preparation and In Vitro Release Behaviors of Paclitaxel-Loaded Pluronic F87/Poly(Lactic Acid) Nanoparticle; Application of High-Efficiency Reverse Osmosis Technology in Reclaimed Water Treatment in Power Plants; Measurement of Ultra Low Sulfur in IN718 by Using Infrared Absorption Method</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">The Synthesis and Characterization of Polyphenylene Vinylene (PPV) Derivatives with Alkoxy Branched ChainsComparison and Characterization of Two Preparation Methods of Graphene Oxide; Detection of Phase Purity of Sr2FeMoO6 by Raman Spectroscopy; A Novel Environment Friendly Material: Sucrose Char Sulfonic Acid Catalyzed Three-Component Mannich Reaction; Investigation of Sewage Sludge Anaerobic Digestion Performance Using Peracetic Acid as a Pretreatment; Synthesis and Characterization of Sulfonated Poly(Arylene Ether Sulfone) Multiblock Copolymers for Proton Exchange Membrane</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Computer science</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Information technology</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Informatique</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Technologie de l'information</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">COMPUTERS</subfield><subfield code="x">Computer Literacy.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">COMPUTERS</subfield><subfield code="x">Computer Science.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">COMPUTERS</subfield><subfield code="x">Data Processing.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">COMPUTERS</subfield><subfield code="x">Hardware</subfield><subfield code="x">General.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">COMPUTERS</subfield><subfield code="x">Information Technology.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">COMPUTERS</subfield><subfield code="x">Machine Theory.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">COMPUTERS</subfield><subfield code="x">Reference.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Computer science</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Information technology</subfield><subfield code="2">fast</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">Conference papers and proceedings</subfield><subfield code="2">fast</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Cai, S. Z.,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="758" ind1=" " ind2=" "><subfield code="i">has work:</subfield><subfield code="a">Materials Science, Computer and Information Technology (Text)</subfield><subfield code="1">https://id.oclc.org/worldcat/entity/E39PCXHgXVw6rWmmhy9BY3X8G3</subfield><subfield code="4">https://id.oclc.org/worldcat/ontology/hasWork</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Print version:</subfield><subfield code="t">Materials science, computer and information technology : selected, peer reviewed papers from the 2014 4 th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China.</subfield><subfield code="d">Switzerland : Trans Tech Publications, ©2014</subfield><subfield code="h">bbb, 57123 pages</subfield><subfield code="k">Advanced materials research ; Volumes 989-994</subfield><subfield code="x">1022-6680</subfield><subfield code="z">9783038351733</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Advanced materials research ;</subfield><subfield code="v">v. 989-994.</subfield><subfield code="0">http://id.loc.gov/authorities/names/n99255722</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="l">FWS01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=826478</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">ProQuest Ebook Central</subfield><subfield code="b">EBLB</subfield><subfield code="n">EBL1910870</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">ebrary</subfield><subfield code="b">EBRY</subfield><subfield code="n">ebr10906076</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">EBSCOhost</subfield><subfield code="b">EBSC</subfield><subfield code="n">826478</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">Trans Tech Publications, Ltd</subfield><subfield code="b">TRAN</subfield><subfield code="n">10.4028/www.scientific.net/AMR.989-994</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">YBP Library Services</subfield><subfield code="b">YANK</subfield><subfield code="n">12016250</subfield></datafield><datafield tag="994" ind1=" " ind2=" "><subfield code="a">92</subfield><subfield code="b">GEBAY</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-863</subfield></datafield></record></collection> |
| genre | Conference papers and proceedings fast |
| genre_facet | Conference papers and proceedings |
| id | ZDB-4-EBA-ocn891381091 |
| illustrated | Illustrated |
| indexdate | 2024-11-27T13:26:13Z |
| institution | BVB |
| isbn | 9783038265566 303826556X |
| issn | 1022-6680 ; 1022-6680 |
| language | English |
| oclc_num | 891381091 |
| open_access_boolean | |
| owner | MAIN DE-863 DE-BY-FWS |
| owner_facet | MAIN DE-863 DE-BY-FWS |
| physical | 1 online resource (5758 pages) : illustrations (some color) |
| psigel | ZDB-4-EBA |
| publishDate | 2014 |
| publishDateSearch | 2014 |
| publishDateSort | 2014 |
| publisher | Trans Tech Publications, |
| record_format | marc |
| series | Advanced materials research ; |
| series2 | Advanced Materials Research, |
| spelling | International Conference on Materials Science and Information Technology (4th : 2014 : Tianjin, China) Materials science, computer and information technology : selected, peer reviewed papers from the 2014 4th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China / edited by S.Z. Cai [and four others]. Switzerland : Trans Tech Publications, [2014] ©2014 1 online resource (5758 pages) : illustrations (some color) text txt rdacontent computer c rdamedia online resource cr rdacarrier Advanced Materials Research, 1022-6680 ; Volumes 989-994 Includes bibliographical references and indexes. Online resource; title from PDF title page (ebrary, viewed August 19, 2014). Collection of selected, peer reviewed papers from the 2014 4th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China. The 1292 papers are grouped as follows: Chapter 1: Advanced Materials Science, Chemical Engineering and Processing Technologies, Chapter 2: Applied Mechanics, Construction and Testing Technologies, Chapter 3: Bio- and Medicine Research, Chapter 4: Resource, Energy and Electronic Development, Environmental Engineering, Chapter 5: Advanced Technologies in Modelling, Simulation and Optimization, Computation Methods and Algorithms, Intelligent Engineering Applications, Chapter 6: Advanced Technologies in Mechanical Engineering, Mechatronics, Automation, Measuremant, Control and Manufacturing Technology, Chapter 7: Communication, Signal and Image Processing, Data Acquisition and Recognation Technologies, Chapter 8: General Principles of Information Technology, WEB and Networks Engineering, Information Security, E-Engineering, Software Application and Development, Chapter 9: Advanced Information and Innovative Technologies for Management, Logistics, Economics, Education, Assessment Keyword: advanced materials, construction technology, applied mechanics, energy and electronics, Environmental Engineering, Intelligent Engineering, Mechatronics, Data Acquisition, signal processing, WEB, E-engineering More than 1,200 papers cover advanced materials science, chemical engineering and processing technologies; applied mechanics, construction, and testing technologies; biological and medical research; resource, energy, and electronic development and environmental engineering; advanced technologies in modeling, simulation, and optimization; computation methods and algorithms and intelligent engineering applications; advanced technologies in mechanical engineering, mechatronics, automation, measurements, control, and manufacturing technology; communication, signal and image processing, and data acquisition and recognition technologies; general principles of information technology, web and networks engineering, information security, electronic engineering, and software application and development; and advanced information and innovation technologies for management, logistics, economics, education, and assessment. -- Computer science-- Information science-- Materials science-- Technology management. Materials Science, Computer and Information Technology; Preface; Table of Contents; Chapter 1: Advanced Materials Science, Chemical Engineering and Processing Technologies; High Value Added Utilization of Vanadium Slag; Preparation of Zeolite 4A Using Laterite Nickel Slag and the Characteristic Study of CO2/N2 Separation; Bi2S3 Nanoflowers Synthesized via Hydrothermal Method; Study of Oxidation Degradation Eosin by Ferrate; The Relationship between Calcium Hydroxide Concentration in Pore Solution and the Strength of Stabilized Soils; Development and Application of the Screw Separator On Laser Shock Processing to Improve Hot Corrosion Resistance of In718 SuperalloyExtraction and Purification of Fluorene from Wash Oil; Microwave Hydrothermal Synthesis and Characterization of In2O3 Nanocrystalline; Synthesis of High-Strength and Water-Resistant Phosphogypsum Small Hollow Block; Study on Laser Micro Shock Effect on Electrical Resistivity of Nanometer Copper Film; Effect of Process Parameters on Residual Stress Distribution during Direct Laser Metal Deposition Shaping; Plasma-Induced Degradation of Benzene in Aqueous Solution Liquid Phase Rhodamine Boxidation Induced by Plasma with Glow Discharge ElectrolysisThe Preparation of ZnO: Al Thin Films on Flexible Substrates by Magnetron Sputtering Method; Analysis Analysis and Suggestions on Device Clamp Screw Fracture of 110kV Transmission Line; Ply Thickness' Effect on Composite Laminate under Low-Velocity Impact; Study on the Synthesis of Ethylene Glycol by Catalytic Hydrolyze of Ethylene Carbonate; Efficient Synthesis 2,3-Dihydroquinazolin-4(1H)-Ones Using Coconut Shell Char Sulfonic Acid as a Reusable Catalyst in Ethanol Study on the Urea Demand Model of SCR Control TechnologyEffect of Sodium Methylacrysulfonate upon the Molecular Weight and Performance of Polycarboxylate Superplasticizer; Influence of the pH Value on the Water-Reducing Performance of Polycarboxylate-Based Superplasticizers at Room Temperature; Preparation and In Vitro Release Behaviors of Paclitaxel-Loaded Pluronic F87/Poly(Lactic Acid) Nanoparticle; Application of High-Efficiency Reverse Osmosis Technology in Reclaimed Water Treatment in Power Plants; Measurement of Ultra Low Sulfur in IN718 by Using Infrared Absorption Method The Synthesis and Characterization of Polyphenylene Vinylene (PPV) Derivatives with Alkoxy Branched ChainsComparison and Characterization of Two Preparation Methods of Graphene Oxide; Detection of Phase Purity of Sr2FeMoO6 by Raman Spectroscopy; A Novel Environment Friendly Material: Sucrose Char Sulfonic Acid Catalyzed Three-Component Mannich Reaction; Investigation of Sewage Sludge Anaerobic Digestion Performance Using Peracetic Acid as a Pretreatment; Synthesis and Characterization of Sulfonated Poly(Arylene Ether Sulfone) Multiblock Copolymers for Proton Exchange Membrane Computer science Congresses. Information technology Congresses. Informatique Congrès. Technologie de l'information Congrès. COMPUTERS Computer Literacy. bisacsh COMPUTERS Computer Science. bisacsh COMPUTERS Data Processing. bisacsh COMPUTERS Hardware General. bisacsh COMPUTERS Information Technology. bisacsh COMPUTERS Machine Theory. bisacsh COMPUTERS Reference. bisacsh Computer science fast Information technology fast Conference papers and proceedings fast Cai, S. Z., editor. has work: Materials Science, Computer and Information Technology (Text) https://id.oclc.org/worldcat/entity/E39PCXHgXVw6rWmmhy9BY3X8G3 https://id.oclc.org/worldcat/ontology/hasWork Print version: Materials science, computer and information technology : selected, peer reviewed papers from the 2014 4 th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China. Switzerland : Trans Tech Publications, ©2014 bbb, 57123 pages Advanced materials research ; Volumes 989-994 1022-6680 9783038351733 Advanced materials research ; v. 989-994. http://id.loc.gov/authorities/names/n99255722 FWS01 ZDB-4-EBA FWS_PDA_EBA https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=826478 Volltext |
| spellingShingle | Materials science, computer and information technology : selected, peer reviewed papers from the 2014 4th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China / Advanced materials research ; Materials Science, Computer and Information Technology; Preface; Table of Contents; Chapter 1: Advanced Materials Science, Chemical Engineering and Processing Technologies; High Value Added Utilization of Vanadium Slag; Preparation of Zeolite 4A Using Laterite Nickel Slag and the Characteristic Study of CO2/N2 Separation; Bi2S3 Nanoflowers Synthesized via Hydrothermal Method; Study of Oxidation Degradation Eosin by Ferrate; The Relationship between Calcium Hydroxide Concentration in Pore Solution and the Strength of Stabilized Soils; Development and Application of the Screw Separator On Laser Shock Processing to Improve Hot Corrosion Resistance of In718 SuperalloyExtraction and Purification of Fluorene from Wash Oil; Microwave Hydrothermal Synthesis and Characterization of In2O3 Nanocrystalline; Synthesis of High-Strength and Water-Resistant Phosphogypsum Small Hollow Block; Study on Laser Micro Shock Effect on Electrical Resistivity of Nanometer Copper Film; Effect of Process Parameters on Residual Stress Distribution during Direct Laser Metal Deposition Shaping; Plasma-Induced Degradation of Benzene in Aqueous Solution Liquid Phase Rhodamine Boxidation Induced by Plasma with Glow Discharge ElectrolysisThe Preparation of ZnO: Al Thin Films on Flexible Substrates by Magnetron Sputtering Method; Analysis Analysis and Suggestions on Device Clamp Screw Fracture of 110kV Transmission Line; Ply Thickness' Effect on Composite Laminate under Low-Velocity Impact; Study on the Synthesis of Ethylene Glycol by Catalytic Hydrolyze of Ethylene Carbonate; Efficient Synthesis 2,3-Dihydroquinazolin-4(1H)-Ones Using Coconut Shell Char Sulfonic Acid as a Reusable Catalyst in Ethanol Study on the Urea Demand Model of SCR Control TechnologyEffect of Sodium Methylacrysulfonate upon the Molecular Weight and Performance of Polycarboxylate Superplasticizer; Influence of the pH Value on the Water-Reducing Performance of Polycarboxylate-Based Superplasticizers at Room Temperature; Preparation and In Vitro Release Behaviors of Paclitaxel-Loaded Pluronic F87/Poly(Lactic Acid) Nanoparticle; Application of High-Efficiency Reverse Osmosis Technology in Reclaimed Water Treatment in Power Plants; Measurement of Ultra Low Sulfur in IN718 by Using Infrared Absorption Method The Synthesis and Characterization of Polyphenylene Vinylene (PPV) Derivatives with Alkoxy Branched ChainsComparison and Characterization of Two Preparation Methods of Graphene Oxide; Detection of Phase Purity of Sr2FeMoO6 by Raman Spectroscopy; A Novel Environment Friendly Material: Sucrose Char Sulfonic Acid Catalyzed Three-Component Mannich Reaction; Investigation of Sewage Sludge Anaerobic Digestion Performance Using Peracetic Acid as a Pretreatment; Synthesis and Characterization of Sulfonated Poly(Arylene Ether Sulfone) Multiblock Copolymers for Proton Exchange Membrane Computer science Congresses. Information technology Congresses. Informatique Congrès. Technologie de l'information Congrès. COMPUTERS Computer Literacy. bisacsh COMPUTERS Computer Science. bisacsh COMPUTERS Data Processing. bisacsh COMPUTERS Hardware General. bisacsh COMPUTERS Information Technology. bisacsh COMPUTERS Machine Theory. bisacsh COMPUTERS Reference. bisacsh Computer science fast Information technology fast |
| title | Materials science, computer and information technology : selected, peer reviewed papers from the 2014 4th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China / |
| title_auth | Materials science, computer and information technology : selected, peer reviewed papers from the 2014 4th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China / |
| title_exact_search | Materials science, computer and information technology : selected, peer reviewed papers from the 2014 4th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China / |
| title_full | Materials science, computer and information technology : selected, peer reviewed papers from the 2014 4th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China / edited by S.Z. Cai [and four others]. |
| title_fullStr | Materials science, computer and information technology : selected, peer reviewed papers from the 2014 4th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China / edited by S.Z. Cai [and four others]. |
| title_full_unstemmed | Materials science, computer and information technology : selected, peer reviewed papers from the 2014 4th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China / edited by S.Z. Cai [and four others]. |
| title_short | Materials science, computer and information technology : |
| title_sort | materials science computer and information technology selected peer reviewed papers from the 2014 4th international conference on materials science and information technology msit 2014 june 14 15 2014 tianjin china |
| title_sub | selected, peer reviewed papers from the 2014 4th International Conference on Materials Science and Information Technology (MSIT 2014), June 14-15, 2014, Tianjin, China / |
| topic | Computer science Congresses. Information technology Congresses. Informatique Congrès. Technologie de l'information Congrès. COMPUTERS Computer Literacy. bisacsh COMPUTERS Computer Science. bisacsh COMPUTERS Data Processing. bisacsh COMPUTERS Hardware General. bisacsh COMPUTERS Information Technology. bisacsh COMPUTERS Machine Theory. bisacsh COMPUTERS Reference. bisacsh Computer science fast Information technology fast |
| topic_facet | Computer science Congresses. Information technology Congresses. Informatique Congrès. Technologie de l'information Congrès. COMPUTERS Computer Literacy. COMPUTERS Computer Science. COMPUTERS Data Processing. COMPUTERS Hardware General. COMPUTERS Information Technology. COMPUTERS Machine Theory. COMPUTERS Reference. Computer science Information technology Conference papers and proceedings |
| url | https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=826478 |
| work_keys_str_mv | AT internationalconferenceonmaterialsscienceandinformationtechnologytianjinchina materialssciencecomputerandinformationtechnologyselectedpeerreviewedpapersfromthe20144thinternationalconferenceonmaterialsscienceandinformationtechnologymsit2014june14152014tianjinchina AT caisz materialssciencecomputerandinformationtechnologyselectedpeerreviewedpapersfromthe20144thinternationalconferenceonmaterialsscienceandinformationtechnologymsit2014june14152014tianjinchina |