Advanced materials science and technology :: selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia /
Collection of selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia. The 157 papers are grouped as follows: Chapter 1: Nanofibers and Membranes, Chapter 2: Nanoparticles and Powde...
Gespeichert in:
| Körperschaft: | |
|---|---|
| Weitere Verfasser: | |
| Format: | Elektronisch Tagungsbericht E-Book |
| Sprache: | English |
| Veröffentlicht: |
Zurich, Switzerland :
Trans Tech Publications,
[2014]
|
| Schriftenreihe: | Advanced materials research ;
v. 896. |
| Schlagworte: | |
| Online-Zugang: | Volltext |
| Zusammenfassung: | Collection of selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia. The 157 papers are grouped as follows: Chapter 1: Nanofibers and Membranes, Chapter 2: Nanoparticles and Powders, Chapter 3: Thick and Thin Films, Chapter 4: Biomaterials, Chapter 5: Electronic Materials, Chapter 6: Magnetic Materials, Chapter 7: Optical Materials, Chapter 8: Composites, Ceramics, and Alloys, Chapter 9: Measurement and Characterization Techniques. The proceedings of the September 2013 confe. |
| Beschreibung: | 1 online resource (744 pages) : illustrations (some color), graphs, photographs |
| Bibliographie: | Includes bibliographical references and indexes. |
| ISBN: | 9783038264125 3038264121 |
| ISSN: | 1662-8985 ; 1662-8985 |
Internformat
MARC
| LEADER | 00000cam a2200000 i 4500 | ||
|---|---|---|---|
| 001 | ZDB-4-EBA-ocn878138258 | ||
| 003 | OCoLC | ||
| 005 | 20241004212047.0 | ||
| 006 | m o d | ||
| 007 | cr cn||||||||| | ||
| 008 | 140322t20142014sz ao ob 101 0 eng d | ||
| 040 | |a E7B |b eng |e rda |e pn |c E7B |d CUS |d N$T |d OCLCO |d UKMGB |d OCLCF |d CUS |d YDXCP |d EBLCP |d DEBSZ |d OCLCO |d OCLCQ |d OCLCO |d OCL |d OCLCO |d AGLDB |d OCLCQ |d VTS |d STF |d M8D |d OCLCQ |d TTECH |d AJS |d OCLCO |d OCLCQ |d OCLCO |d OCLCL | ||
| 016 | 7 | |a 016788837 |2 Uk | |
| 019 | |a 899158752 | ||
| 020 | |a 9783038264125 |q (electronic bk.) | ||
| 020 | |a 3038264121 |q (electronic bk.) | ||
| 020 | |z 9783038350316 | ||
| 035 | |a (OCoLC)878138258 |z (OCoLC)899158752 | ||
| 050 | 4 | |a TA401.3 |b .A383 2014eb | |
| 072 | 7 | |a TEC |x 009000 |2 bisacsh | |
| 072 | 7 | |a TEC |x 035000 |2 bisacsh | |
| 082 | 7 | |a 620.11 |2 23 | |
| 049 | |a MAIN | ||
| 111 | 2 | |a International Conference on Advanced Materials Science and Technology |d (2013 : |c Yogyakarta, Indonesia) | |
| 245 | 1 | 0 | |a Advanced materials science and technology : |b selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia / |c edited by Kuwat Triyana [and four others]. |
| 264 | 1 | |a Zurich, Switzerland : |b Trans Tech Publications, |c [2014] | |
| 264 | 4 | |c ©2014 | |
| 300 | |a 1 online resource (744 pages) : |b illustrations (some color), graphs, photographs | ||
| 336 | |a text |b txt |2 rdacontent | ||
| 337 | |a computer |b c |2 rdamedia | ||
| 338 | |a online resource |b cr |2 rdacarrier | ||
| 490 | 1 | |a Advanced Materials Research, |x 1662-8985 ; |v vol. 896 | |
| 504 | |a Includes bibliographical references and indexes. | ||
| 588 | 0 | |a Online resource; title from PDF title page (ebrary, viewed March 20, 2014). | |
| 505 | 0 | |a Advanced Materials Science and Technology; Preface and Conference Organizers; Table of Contents; Chapter 1: Nanofibers and Membranes; The Role and Prospect of Nanomaterials in Polymeric Membrane for Water and Wastewater Treatment: A State-of-the-Art Overview; Synthesis of Low Fouling Porous Polymeric Membranes; Mass Production of Stacked Styrofoam Nanofibers Using a Multinozzle and Drum Collector Electrospinning System; Transparent and Conductive Fluorinated-Tin Oxide Prepared by Atmospheric Deposition Technique; Gas Sensing Using Static and Dynamic Modes Piezoresistive Microcantilever. | |
| 505 | 8 | |a One-Step Fabrication of Short Nanofibers by Electrospinning: Effect of Needle Size on Nanofiber LengthCarbon Dioxide Permeation Characteristics in Asymmetric Polysulfone Hollow Fiber Membrane: Effect of Constant Heating and Progressive Heating; Electrospinning of Poly(vinyl alcohol)/Chitosan via Multi-Nozzle Spinneret and Drum Collector; A Simple Way of Producing Nano Anatase TiO2 in Polyvinyl Alcohol Fibers; The Crystal Structure, Conductivity Character and Ionic Migration of Samarium Doped-Ceria (SDC) and its Composite with Sodium Carbonate. | |
| 505 | 8 | |a Preparation of Sulfonate Grafted Silica/Chitosan-Based Proton Exchange MembraneSynthesis and Characterization of Solid Polymer Electrolyte from N-Succinyl Chitosan and Lithium Perchlorate; Epoxidised Natural Rubber Based Polymer Electrolyte Systems for Electrochemical Device Applications; Eggs Shell Membrane as Natural Separator for Supercapacitor Applications; Titania Coated Ceramic Membrane from Clay and Muntilan Sand for Wastewater Filter Application; Utilization of Fly Ash as Ceramic Support Mixture for the Synthesis of Zeolite Pervaporation Membrane. | |
| 505 | 8 | |a Synthesis and Characterization of Nanostructured Tungsten Oxide by Hard Template MethodChapter 2: Nanoparticles and Powders; Excited-State Proton Transfer in Fluorescent Photoactive Yellow Protein Containing 7-Hydroxycoumarin; Effect of Heating Time on Atrazine-Based MIP Materials Synthesized via the Cooling-Heating Method; Preparation of Orange Peel Based Activated Carbons as Cathodes in Lithium Ion Capacitors; Synthesis of Fe2O3/C Nanocomposite Using Microwave Assisted Calcination Method; Magnetic CuFe2O4 Nanoparticles for Adsorpstion of Cr(VI) from Aqueous Solution. | |
| 505 | 8 | |a Optical Properties of Zn-Doped CeO2 Nanoparticles as a Function of Zn ContentChelating Agent Role in Synthesizing Cerate-Zirconate Powder by a Sol-Gel Method; Influence of Ionic Surfactants under Ultrasonic Irradiation to Reduce the Particle Size of Mechanically Alloyed La1-XSrX Fe0.5Mn0.25Ti0.25O3 Powders; Covalent Functionalization of Amino Group onto Carbon-Based Magnetic Nanoparticles Using Pulsed-Powder Explosion Technique; Magnetic Properties and Microstructures of Polyethylene Glycol (PEG)-Coated Cobalt Ferrite (CoFe2O4) Nanoparticles Synthesized by Coprecipitation Method. | |
| 520 | |a Collection of selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia. The 157 papers are grouped as follows: Chapter 1: Nanofibers and Membranes, Chapter 2: Nanoparticles and Powders, Chapter 3: Thick and Thin Films, Chapter 4: Biomaterials, Chapter 5: Electronic Materials, Chapter 6: Magnetic Materials, Chapter 7: Optical Materials, Chapter 8: Composites, Ceramics, and Alloys, Chapter 9: Measurement and Characterization Techniques. The proceedings of the September 2013 confe. | ||
| 650 | 0 | |a Materials science |v Congresses. | |
| 650 | 0 | |a Technology |v Congresses. | |
| 650 | 6 | |a Science des matériaux |v Congrès. | |
| 650 | 6 | |a Technologie |v Congrès. | |
| 650 | 7 | |a TECHNOLOGY & ENGINEERING |x Engineering (General) |2 bisacsh | |
| 650 | 7 | |a TECHNOLOGY & ENGINEERING |x Reference. |2 bisacsh | |
| 650 | 7 | |a Materials science |2 fast | |
| 650 | 7 | |a Technology |2 fast | |
| 655 | 7 | |a Conference papers and proceedings |2 fast | |
| 700 | 1 | |a Triyana, Kuwat, |e editor. | |
| 758 | |i has work: |a Advanced Materials Science and Technology (Text) |1 https://id.oclc.org/worldcat/entity/E39PCYr7vHWYf3wCMyfPyVtc8C |4 https://id.oclc.org/worldcat/ontology/hasWork | ||
| 776 | 0 | 8 | |i Print version: |t Advanced materials science and technology : selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia. |d Zurich, Switzerland : TTP, ©2014 |h 743 pages |k Advanced materials research ; Volume 896 |x 1662-8985 |z 9783038350316 |
| 830 | 0 | |a Advanced materials research ; |v v. 896. |0 http://id.loc.gov/authorities/names/n99255722 | |
| 856 | 4 | 0 | |l FWS01 |p ZDB-4-EBA |q FWS_PDA_EBA |u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711973 |3 Volltext |
| 938 | |a ProQuest Ebook Central |b EBLB |n EBL1910728 | ||
| 938 | |a ebrary |b EBRY |n ebr10846254 | ||
| 938 | |a EBSCOhost |b EBSC |n 711973 | ||
| 938 | |a Trans Tech Publications, Ltd |b TRAN |n 10.4028/www.scientific.net/AMR.896 | ||
| 938 | |a YBP Library Services |b YANK |n 11697660 | ||
| 994 | |a 92 |b GEBAY | ||
| 912 | |a ZDB-4-EBA | ||
| 049 | |a DE-863 | ||
Datensatz im Suchindex
| DE-BY-FWS_katkey | ZDB-4-EBA-ocn878138258 |
|---|---|
| _version_ | 1816882269613195264 |
| adam_text | |
| any_adam_object | |
| author2 | Triyana, Kuwat |
| author2_role | edt |
| author2_variant | k t kt |
| author_corporate | International Conference on Advanced Materials Science and Technology Yogyakarta, Indonesia |
| author_corporate_role | |
| author_facet | Triyana, Kuwat International Conference on Advanced Materials Science and Technology Yogyakarta, Indonesia |
| author_sort | International Conference on Advanced Materials Science and Technology Yogyakarta, Indonesia |
| building | Verbundindex |
| bvnumber | localFWS |
| callnumber-first | T - Technology |
| callnumber-label | TA401 |
| callnumber-raw | TA401.3 .A383 2014eb |
| callnumber-search | TA401.3 .A383 2014eb |
| callnumber-sort | TA 3401.3 A383 42014EB |
| callnumber-subject | TA - General and Civil Engineering |
| collection | ZDB-4-EBA |
| contents | Advanced Materials Science and Technology; Preface and Conference Organizers; Table of Contents; Chapter 1: Nanofibers and Membranes; The Role and Prospect of Nanomaterials in Polymeric Membrane for Water and Wastewater Treatment: A State-of-the-Art Overview; Synthesis of Low Fouling Porous Polymeric Membranes; Mass Production of Stacked Styrofoam Nanofibers Using a Multinozzle and Drum Collector Electrospinning System; Transparent and Conductive Fluorinated-Tin Oxide Prepared by Atmospheric Deposition Technique; Gas Sensing Using Static and Dynamic Modes Piezoresistive Microcantilever. One-Step Fabrication of Short Nanofibers by Electrospinning: Effect of Needle Size on Nanofiber LengthCarbon Dioxide Permeation Characteristics in Asymmetric Polysulfone Hollow Fiber Membrane: Effect of Constant Heating and Progressive Heating; Electrospinning of Poly(vinyl alcohol)/Chitosan via Multi-Nozzle Spinneret and Drum Collector; A Simple Way of Producing Nano Anatase TiO2 in Polyvinyl Alcohol Fibers; The Crystal Structure, Conductivity Character and Ionic Migration of Samarium Doped-Ceria (SDC) and its Composite with Sodium Carbonate. Preparation of Sulfonate Grafted Silica/Chitosan-Based Proton Exchange MembraneSynthesis and Characterization of Solid Polymer Electrolyte from N-Succinyl Chitosan and Lithium Perchlorate; Epoxidised Natural Rubber Based Polymer Electrolyte Systems for Electrochemical Device Applications; Eggs Shell Membrane as Natural Separator for Supercapacitor Applications; Titania Coated Ceramic Membrane from Clay and Muntilan Sand for Wastewater Filter Application; Utilization of Fly Ash as Ceramic Support Mixture for the Synthesis of Zeolite Pervaporation Membrane. Synthesis and Characterization of Nanostructured Tungsten Oxide by Hard Template MethodChapter 2: Nanoparticles and Powders; Excited-State Proton Transfer in Fluorescent Photoactive Yellow Protein Containing 7-Hydroxycoumarin; Effect of Heating Time on Atrazine-Based MIP Materials Synthesized via the Cooling-Heating Method; Preparation of Orange Peel Based Activated Carbons as Cathodes in Lithium Ion Capacitors; Synthesis of Fe2O3/C Nanocomposite Using Microwave Assisted Calcination Method; Magnetic CuFe2O4 Nanoparticles for Adsorpstion of Cr(VI) from Aqueous Solution. Optical Properties of Zn-Doped CeO2 Nanoparticles as a Function of Zn ContentChelating Agent Role in Synthesizing Cerate-Zirconate Powder by a Sol-Gel Method; Influence of Ionic Surfactants under Ultrasonic Irradiation to Reduce the Particle Size of Mechanically Alloyed La1-XSrX Fe0.5Mn0.25Ti0.25O3 Powders; Covalent Functionalization of Amino Group onto Carbon-Based Magnetic Nanoparticles Using Pulsed-Powder Explosion Technique; Magnetic Properties and Microstructures of Polyethylene Glycol (PEG)-Coated Cobalt Ferrite (CoFe2O4) Nanoparticles Synthesized by Coprecipitation Method. |
| ctrlnum | (OCoLC)878138258 |
| dewey-full | 620.11 |
| dewey-hundreds | 600 - Technology (Applied sciences) |
| dewey-ones | 620 - Engineering and allied operations |
| dewey-raw | 620.11 |
| dewey-search | 620.11 |
| dewey-sort | 3620.11 |
| dewey-tens | 620 - Engineering and allied operations |
| format | Electronic Conference Proceeding eBook |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>06855cam a2200685 i 4500</leader><controlfield tag="001">ZDB-4-EBA-ocn878138258</controlfield><controlfield tag="003">OCoLC</controlfield><controlfield tag="005">20241004212047.0</controlfield><controlfield tag="006">m o d </controlfield><controlfield tag="007">cr cn|||||||||</controlfield><controlfield tag="008">140322t20142014sz ao ob 101 0 eng d</controlfield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">E7B</subfield><subfield code="b">eng</subfield><subfield code="e">rda</subfield><subfield code="e">pn</subfield><subfield code="c">E7B</subfield><subfield code="d">CUS</subfield><subfield code="d">N$T</subfield><subfield code="d">OCLCO</subfield><subfield code="d">UKMGB</subfield><subfield code="d">OCLCF</subfield><subfield code="d">CUS</subfield><subfield code="d">YDXCP</subfield><subfield code="d">EBLCP</subfield><subfield code="d">DEBSZ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCL</subfield><subfield code="d">OCLCO</subfield><subfield code="d">AGLDB</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">VTS</subfield><subfield code="d">STF</subfield><subfield code="d">M8D</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">TTECH</subfield><subfield code="d">AJS</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCL</subfield></datafield><datafield tag="016" ind1="7" ind2=" "><subfield code="a">016788837</subfield><subfield code="2">Uk</subfield></datafield><datafield tag="019" ind1=" " ind2=" "><subfield code="a">899158752</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038264125</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3038264121</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">9783038350316</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)878138258</subfield><subfield code="z">(OCoLC)899158752</subfield></datafield><datafield tag="050" ind1=" " ind2="4"><subfield code="a">TA401.3</subfield><subfield code="b">.A383 2014eb</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">TEC</subfield><subfield code="x">009000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">TEC</subfield><subfield code="x">035000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="082" ind1="7" ind2=" "><subfield code="a">620.11</subfield><subfield code="2">23</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">MAIN</subfield></datafield><datafield tag="111" ind1="2" ind2=" "><subfield code="a">International Conference on Advanced Materials Science and Technology</subfield><subfield code="d">(2013 :</subfield><subfield code="c">Yogyakarta, Indonesia)</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Advanced materials science and technology :</subfield><subfield code="b">selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia /</subfield><subfield code="c">edited by Kuwat Triyana [and four others].</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Zurich, Switzerland :</subfield><subfield code="b">Trans Tech Publications,</subfield><subfield code="c">[2014]</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">©2014</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (744 pages) :</subfield><subfield code="b">illustrations (some color), graphs, photographs</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">computer</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">online resource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Advanced Materials Research,</subfield><subfield code="x">1662-8985 ;</subfield><subfield code="v">vol. 896</subfield></datafield><datafield tag="504" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references and indexes.</subfield></datafield><datafield tag="588" ind1="0" ind2=" "><subfield code="a">Online resource; title from PDF title page (ebrary, viewed March 20, 2014).</subfield></datafield><datafield tag="505" ind1="0" ind2=" "><subfield code="a">Advanced Materials Science and Technology; Preface and Conference Organizers; Table of Contents; Chapter 1: Nanofibers and Membranes; The Role and Prospect of Nanomaterials in Polymeric Membrane for Water and Wastewater Treatment: A State-of-the-Art Overview; Synthesis of Low Fouling Porous Polymeric Membranes; Mass Production of Stacked Styrofoam Nanofibers Using a Multinozzle and Drum Collector Electrospinning System; Transparent and Conductive Fluorinated-Tin Oxide Prepared by Atmospheric Deposition Technique; Gas Sensing Using Static and Dynamic Modes Piezoresistive Microcantilever.</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">One-Step Fabrication of Short Nanofibers by Electrospinning: Effect of Needle Size on Nanofiber LengthCarbon Dioxide Permeation Characteristics in Asymmetric Polysulfone Hollow Fiber Membrane: Effect of Constant Heating and Progressive Heating; Electrospinning of Poly(vinyl alcohol)/Chitosan via Multi-Nozzle Spinneret and Drum Collector; A Simple Way of Producing Nano Anatase TiO2 in Polyvinyl Alcohol Fibers; The Crystal Structure, Conductivity Character and Ionic Migration of Samarium Doped-Ceria (SDC) and its Composite with Sodium Carbonate.</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Preparation of Sulfonate Grafted Silica/Chitosan-Based Proton Exchange MembraneSynthesis and Characterization of Solid Polymer Electrolyte from N-Succinyl Chitosan and Lithium Perchlorate; Epoxidised Natural Rubber Based Polymer Electrolyte Systems for Electrochemical Device Applications; Eggs Shell Membrane as Natural Separator for Supercapacitor Applications; Titania Coated Ceramic Membrane from Clay and Muntilan Sand for Wastewater Filter Application; Utilization of Fly Ash as Ceramic Support Mixture for the Synthesis of Zeolite Pervaporation Membrane.</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Synthesis and Characterization of Nanostructured Tungsten Oxide by Hard Template MethodChapter 2: Nanoparticles and Powders; Excited-State Proton Transfer in Fluorescent Photoactive Yellow Protein Containing 7-Hydroxycoumarin; Effect of Heating Time on Atrazine-Based MIP Materials Synthesized via the Cooling-Heating Method; Preparation of Orange Peel Based Activated Carbons as Cathodes in Lithium Ion Capacitors; Synthesis of Fe2O3/C Nanocomposite Using Microwave Assisted Calcination Method; Magnetic CuFe2O4 Nanoparticles for Adsorpstion of Cr(VI) from Aqueous Solution.</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Optical Properties of Zn-Doped CeO2 Nanoparticles as a Function of Zn ContentChelating Agent Role in Synthesizing Cerate-Zirconate Powder by a Sol-Gel Method; Influence of Ionic Surfactants under Ultrasonic Irradiation to Reduce the Particle Size of Mechanically Alloyed La1-XSrX Fe0.5Mn0.25Ti0.25O3 Powders; Covalent Functionalization of Amino Group onto Carbon-Based Magnetic Nanoparticles Using Pulsed-Powder Explosion Technique; Magnetic Properties and Microstructures of Polyethylene Glycol (PEG)-Coated Cobalt Ferrite (CoFe2O4) Nanoparticles Synthesized by Coprecipitation Method.</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Collection of selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia. The 157 papers are grouped as follows: Chapter 1: Nanofibers and Membranes, Chapter 2: Nanoparticles and Powders, Chapter 3: Thick and Thin Films, Chapter 4: Biomaterials, Chapter 5: Electronic Materials, Chapter 6: Magnetic Materials, Chapter 7: Optical Materials, Chapter 8: Composites, Ceramics, and Alloys, Chapter 9: Measurement and Characterization Techniques. The proceedings of the September 2013 confe.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Materials science</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Technology</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Science des matériaux</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Technologie</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING</subfield><subfield code="x">Engineering (General)</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING</subfield><subfield code="x">Reference.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Materials science</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Technology</subfield><subfield code="2">fast</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">Conference papers and proceedings</subfield><subfield code="2">fast</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Triyana, Kuwat,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="758" ind1=" " ind2=" "><subfield code="i">has work:</subfield><subfield code="a">Advanced Materials Science and Technology (Text)</subfield><subfield code="1">https://id.oclc.org/worldcat/entity/E39PCYr7vHWYf3wCMyfPyVtc8C</subfield><subfield code="4">https://id.oclc.org/worldcat/ontology/hasWork</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Print version:</subfield><subfield code="t">Advanced materials science and technology : selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia.</subfield><subfield code="d">Zurich, Switzerland : TTP, ©2014</subfield><subfield code="h">743 pages</subfield><subfield code="k">Advanced materials research ; Volume 896</subfield><subfield code="x">1662-8985</subfield><subfield code="z">9783038350316</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Advanced materials research ;</subfield><subfield code="v">v. 896.</subfield><subfield code="0">http://id.loc.gov/authorities/names/n99255722</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="l">FWS01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711973</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">ProQuest Ebook Central</subfield><subfield code="b">EBLB</subfield><subfield code="n">EBL1910728</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">ebrary</subfield><subfield code="b">EBRY</subfield><subfield code="n">ebr10846254</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">EBSCOhost</subfield><subfield code="b">EBSC</subfield><subfield code="n">711973</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">Trans Tech Publications, Ltd</subfield><subfield code="b">TRAN</subfield><subfield code="n">10.4028/www.scientific.net/AMR.896</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">YBP Library Services</subfield><subfield code="b">YANK</subfield><subfield code="n">11697660</subfield></datafield><datafield tag="994" ind1=" " ind2=" "><subfield code="a">92</subfield><subfield code="b">GEBAY</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-863</subfield></datafield></record></collection> |
| genre | Conference papers and proceedings fast |
| genre_facet | Conference papers and proceedings |
| id | ZDB-4-EBA-ocn878138258 |
| illustrated | Illustrated |
| indexdate | 2024-11-27T13:25:56Z |
| institution | BVB |
| isbn | 9783038264125 3038264121 |
| issn | 1662-8985 ; 1662-8985 |
| language | English |
| oclc_num | 878138258 |
| open_access_boolean | |
| owner | MAIN DE-863 DE-BY-FWS |
| owner_facet | MAIN DE-863 DE-BY-FWS |
| physical | 1 online resource (744 pages) : illustrations (some color), graphs, photographs |
| psigel | ZDB-4-EBA |
| publishDate | 2014 |
| publishDateSearch | 2014 |
| publishDateSort | 2014 |
| publisher | Trans Tech Publications, |
| record_format | marc |
| series | Advanced materials research ; |
| series2 | Advanced Materials Research, |
| spelling | International Conference on Advanced Materials Science and Technology (2013 : Yogyakarta, Indonesia) Advanced materials science and technology : selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia / edited by Kuwat Triyana [and four others]. Zurich, Switzerland : Trans Tech Publications, [2014] ©2014 1 online resource (744 pages) : illustrations (some color), graphs, photographs text txt rdacontent computer c rdamedia online resource cr rdacarrier Advanced Materials Research, 1662-8985 ; vol. 896 Includes bibliographical references and indexes. Online resource; title from PDF title page (ebrary, viewed March 20, 2014). Advanced Materials Science and Technology; Preface and Conference Organizers; Table of Contents; Chapter 1: Nanofibers and Membranes; The Role and Prospect of Nanomaterials in Polymeric Membrane for Water and Wastewater Treatment: A State-of-the-Art Overview; Synthesis of Low Fouling Porous Polymeric Membranes; Mass Production of Stacked Styrofoam Nanofibers Using a Multinozzle and Drum Collector Electrospinning System; Transparent and Conductive Fluorinated-Tin Oxide Prepared by Atmospheric Deposition Technique; Gas Sensing Using Static and Dynamic Modes Piezoresistive Microcantilever. One-Step Fabrication of Short Nanofibers by Electrospinning: Effect of Needle Size on Nanofiber LengthCarbon Dioxide Permeation Characteristics in Asymmetric Polysulfone Hollow Fiber Membrane: Effect of Constant Heating and Progressive Heating; Electrospinning of Poly(vinyl alcohol)/Chitosan via Multi-Nozzle Spinneret and Drum Collector; A Simple Way of Producing Nano Anatase TiO2 in Polyvinyl Alcohol Fibers; The Crystal Structure, Conductivity Character and Ionic Migration of Samarium Doped-Ceria (SDC) and its Composite with Sodium Carbonate. Preparation of Sulfonate Grafted Silica/Chitosan-Based Proton Exchange MembraneSynthesis and Characterization of Solid Polymer Electrolyte from N-Succinyl Chitosan and Lithium Perchlorate; Epoxidised Natural Rubber Based Polymer Electrolyte Systems for Electrochemical Device Applications; Eggs Shell Membrane as Natural Separator for Supercapacitor Applications; Titania Coated Ceramic Membrane from Clay and Muntilan Sand for Wastewater Filter Application; Utilization of Fly Ash as Ceramic Support Mixture for the Synthesis of Zeolite Pervaporation Membrane. Synthesis and Characterization of Nanostructured Tungsten Oxide by Hard Template MethodChapter 2: Nanoparticles and Powders; Excited-State Proton Transfer in Fluorescent Photoactive Yellow Protein Containing 7-Hydroxycoumarin; Effect of Heating Time on Atrazine-Based MIP Materials Synthesized via the Cooling-Heating Method; Preparation of Orange Peel Based Activated Carbons as Cathodes in Lithium Ion Capacitors; Synthesis of Fe2O3/C Nanocomposite Using Microwave Assisted Calcination Method; Magnetic CuFe2O4 Nanoparticles for Adsorpstion of Cr(VI) from Aqueous Solution. Optical Properties of Zn-Doped CeO2 Nanoparticles as a Function of Zn ContentChelating Agent Role in Synthesizing Cerate-Zirconate Powder by a Sol-Gel Method; Influence of Ionic Surfactants under Ultrasonic Irradiation to Reduce the Particle Size of Mechanically Alloyed La1-XSrX Fe0.5Mn0.25Ti0.25O3 Powders; Covalent Functionalization of Amino Group onto Carbon-Based Magnetic Nanoparticles Using Pulsed-Powder Explosion Technique; Magnetic Properties and Microstructures of Polyethylene Glycol (PEG)-Coated Cobalt Ferrite (CoFe2O4) Nanoparticles Synthesized by Coprecipitation Method. Collection of selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia. The 157 papers are grouped as follows: Chapter 1: Nanofibers and Membranes, Chapter 2: Nanoparticles and Powders, Chapter 3: Thick and Thin Films, Chapter 4: Biomaterials, Chapter 5: Electronic Materials, Chapter 6: Magnetic Materials, Chapter 7: Optical Materials, Chapter 8: Composites, Ceramics, and Alloys, Chapter 9: Measurement and Characterization Techniques. The proceedings of the September 2013 confe. Materials science Congresses. Technology Congresses. Science des matériaux Congrès. Technologie Congrès. TECHNOLOGY & ENGINEERING Engineering (General) bisacsh TECHNOLOGY & ENGINEERING Reference. bisacsh Materials science fast Technology fast Conference papers and proceedings fast Triyana, Kuwat, editor. has work: Advanced Materials Science and Technology (Text) https://id.oclc.org/worldcat/entity/E39PCYr7vHWYf3wCMyfPyVtc8C https://id.oclc.org/worldcat/ontology/hasWork Print version: Advanced materials science and technology : selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia. Zurich, Switzerland : TTP, ©2014 743 pages Advanced materials research ; Volume 896 1662-8985 9783038350316 Advanced materials research ; v. 896. http://id.loc.gov/authorities/names/n99255722 FWS01 ZDB-4-EBA FWS_PDA_EBA https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711973 Volltext |
| spellingShingle | Advanced materials science and technology : selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia / Advanced materials research ; Advanced Materials Science and Technology; Preface and Conference Organizers; Table of Contents; Chapter 1: Nanofibers and Membranes; The Role and Prospect of Nanomaterials in Polymeric Membrane for Water and Wastewater Treatment: A State-of-the-Art Overview; Synthesis of Low Fouling Porous Polymeric Membranes; Mass Production of Stacked Styrofoam Nanofibers Using a Multinozzle and Drum Collector Electrospinning System; Transparent and Conductive Fluorinated-Tin Oxide Prepared by Atmospheric Deposition Technique; Gas Sensing Using Static and Dynamic Modes Piezoresistive Microcantilever. One-Step Fabrication of Short Nanofibers by Electrospinning: Effect of Needle Size on Nanofiber LengthCarbon Dioxide Permeation Characteristics in Asymmetric Polysulfone Hollow Fiber Membrane: Effect of Constant Heating and Progressive Heating; Electrospinning of Poly(vinyl alcohol)/Chitosan via Multi-Nozzle Spinneret and Drum Collector; A Simple Way of Producing Nano Anatase TiO2 in Polyvinyl Alcohol Fibers; The Crystal Structure, Conductivity Character and Ionic Migration of Samarium Doped-Ceria (SDC) and its Composite with Sodium Carbonate. Preparation of Sulfonate Grafted Silica/Chitosan-Based Proton Exchange MembraneSynthesis and Characterization of Solid Polymer Electrolyte from N-Succinyl Chitosan and Lithium Perchlorate; Epoxidised Natural Rubber Based Polymer Electrolyte Systems for Electrochemical Device Applications; Eggs Shell Membrane as Natural Separator for Supercapacitor Applications; Titania Coated Ceramic Membrane from Clay and Muntilan Sand for Wastewater Filter Application; Utilization of Fly Ash as Ceramic Support Mixture for the Synthesis of Zeolite Pervaporation Membrane. Synthesis and Characterization of Nanostructured Tungsten Oxide by Hard Template MethodChapter 2: Nanoparticles and Powders; Excited-State Proton Transfer in Fluorescent Photoactive Yellow Protein Containing 7-Hydroxycoumarin; Effect of Heating Time on Atrazine-Based MIP Materials Synthesized via the Cooling-Heating Method; Preparation of Orange Peel Based Activated Carbons as Cathodes in Lithium Ion Capacitors; Synthesis of Fe2O3/C Nanocomposite Using Microwave Assisted Calcination Method; Magnetic CuFe2O4 Nanoparticles for Adsorpstion of Cr(VI) from Aqueous Solution. Optical Properties of Zn-Doped CeO2 Nanoparticles as a Function of Zn ContentChelating Agent Role in Synthesizing Cerate-Zirconate Powder by a Sol-Gel Method; Influence of Ionic Surfactants under Ultrasonic Irradiation to Reduce the Particle Size of Mechanically Alloyed La1-XSrX Fe0.5Mn0.25Ti0.25O3 Powders; Covalent Functionalization of Amino Group onto Carbon-Based Magnetic Nanoparticles Using Pulsed-Powder Explosion Technique; Magnetic Properties and Microstructures of Polyethylene Glycol (PEG)-Coated Cobalt Ferrite (CoFe2O4) Nanoparticles Synthesized by Coprecipitation Method. Materials science Congresses. Technology Congresses. Science des matériaux Congrès. Technologie Congrès. TECHNOLOGY & ENGINEERING Engineering (General) bisacsh TECHNOLOGY & ENGINEERING Reference. bisacsh Materials science fast Technology fast |
| title | Advanced materials science and technology : selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia / |
| title_auth | Advanced materials science and technology : selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia / |
| title_exact_search | Advanced materials science and technology : selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia / |
| title_full | Advanced materials science and technology : selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia / edited by Kuwat Triyana [and four others]. |
| title_fullStr | Advanced materials science and technology : selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia / edited by Kuwat Triyana [and four others]. |
| title_full_unstemmed | Advanced materials science and technology : selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia / edited by Kuwat Triyana [and four others]. |
| title_short | Advanced materials science and technology : |
| title_sort | advanced materials science and technology selected peer reviewed papers from the 2013 international conference on advanced materials science and technology icamst 2013 september 17 18 2013 yogyakarta indonesia |
| title_sub | selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia / |
| topic | Materials science Congresses. Technology Congresses. Science des matériaux Congrès. Technologie Congrès. TECHNOLOGY & ENGINEERING Engineering (General) bisacsh TECHNOLOGY & ENGINEERING Reference. bisacsh Materials science fast Technology fast |
| topic_facet | Materials science Congresses. Technology Congresses. Science des matériaux Congrès. Technologie Congrès. TECHNOLOGY & ENGINEERING Engineering (General) TECHNOLOGY & ENGINEERING Reference. Materials science Technology Conference papers and proceedings |
| url | https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711973 |
| work_keys_str_mv | AT internationalconferenceonadvancedmaterialsscienceandtechnologyyogyakartaindonesia advancedmaterialsscienceandtechnologyselectedpeerreviewedpapersfromthe2013internationalconferenceonadvancedmaterialsscienceandtechnologyicamst2013september17182013yogyakartaindonesia AT triyanakuwat advancedmaterialsscienceandtechnologyselectedpeerreviewedpapersfromthe2013internationalconferenceonadvancedmaterialsscienceandtechnologyicamst2013september17182013yogyakartaindonesia |