Verfügbarkeit: Frontier of Nanoscience and Technology II :

Frontier of Nanoscience and Technology II :: selected, peer reviewed papers from the 2012 International Conference on Frontiers of Nanoscience and Technology (ICFNST 2012), July 26-27, 2012, Hongkong /

This book comprises 62 peer-reviewed papers on the topics of Nanoscience and Materials Technology, and has the aim of promoting the development of Nanoscience and Materials Technology, strengthening international academic cooperation and communications and exchanging research ideas. This work provid...

Ausführliche Beschreibung

Gespeichert in:

Bibliographische Detailangaben
Körperschaft:	International Conference on Frontiers of Nanoscience and Technology Hong Kong, China
Weitere Verfasser:	Kao, Jimmy C. M. (Jimmy Chih-Ming), 1963- (HerausgeberIn), Hou, Meng (HerausgeberIn), Chen, Ran, (Mechanical engineer) (HerausgeberIn)
Format:	Elektronisch Tagungsbericht E-Book
Sprache:	English
Veröffentlicht:	Durnten-Zurich, Switzerland ; Enfield, NH : Trans Tech Publications, ©2012. ©2012
Schriftenreihe:	Advanced materials research ; v. 528.
Schlagworte:	Nanotechnology > Congresses. Nanoscience > Congresses. Nanosciences > Congrès. Nanotechnologie > Congrès. SCIENCE > Nanoscience. TECHNOLOGY & ENGINEERING > Nanotechnology & MEMS. Nanoscience Nanotechnology ICFNST Conference papers and proceedings
Online-Zugang:	DE-862 DE-863
Zusammenfassung:	This book comprises 62 peer-reviewed papers on the topics of Nanoscience and Materials Technology, and has the aim of promoting the development of Nanoscience and Materials Technology, strengthening international academic cooperation and communications and exchanging research ideas. This work provides readers with a broad overview of the latest advances in the field of Nanoscience and Materials Technology. Kao (National Sun Yat-Sen U., Taiwan) et al. collect 62 papers from the 2012 International Conference on Frontiers of Nanoscience and Technology (ICFNST 2012), held in July in Hong Kong. Researchers, engineers, academics, and industry professionals mainly from Asia present research results and development activities in nanoscience and technology, including nanoparticle manufacturing, mechanical properties, the design and fabrication, development, preparation and characterization, manufacturing processes, polymerization, nanostructure, performance, and materials engineering of various materials, such as aluminum thin films, capsaicin injectable gels, lithium-ion batteries, starch, Nifeviroc-loaded microemulsions, and nanowires.
Beschreibung:	1 online resource (x, 291 pages) : illustrations (some color)
Bibliographie:	Includes bibliographical references and index.
ISBN:	9783038138433 3038138436
ISSN:	1022-6680 ;

Internformat

MARC


LEADER	00000cam a2200000 a 4500
001	ZDB-4-EBA-ocn827788098
003	OCoLC
005	20250103110447.0
006	m o d
007	cr cnu---unuuu
008	130215s2012 sz a ob 101 0 eng d
010			\|a 2012382029
040			\|a N$T \|b eng \|e pn \|c N$T \|d MUU \|d WAU \|d OKU \|d CUS \|d YDXCP \|d OCLCF \|d OCLCO \|d OCLCQ \|d OCLCO \|d E7B \|d EBLCP \|d DEBSZ \|d OCLCO \|d LLB \|d OCL \|d OCLCO \|d OCLCQ \|d OCLCO \|d COCUF \|d AGLDB \|d MOR \|d CCO \|d PIFAG \|d MERUC \|d OCLCQ \|d ZCU \|d U3W \|d STF \|d VTS \|d NRAMU \|d ICG \|d OCLCQ \|d INT \|d VT2 \|d OCLCQ \|d WYU \|d TKN \|d OCLCQ \|d DKC \|d OCLCQ \|d M8D \|d OCLCQ \|d HS0 \|d OCLCQ \|d TTECH \|d AJS \|d OCLCO \|d OCLCQ \|d OCLCO \|d OCLCL \|d OCLCQ \|d OCLCL \|d OCLCQ
016	7		\|a 016171451 \|2 Uk
019			\|a 812546991 \|a 872666879 \|a 961579951 \|a 1055339519 \|a 1066437127 \|a 1081227355 \|a 1228539146
020			\|a 9783038138433 \|q (electronic bk.)
020			\|a 3038138436 \|q (electronic bk.)
020			\|z 9783037854297
020			\|z 3037854294
035			\|a (OCoLC)827788098 \|z (OCoLC)812546991 \|z (OCoLC)872666879 \|z (OCoLC)961579951 \|z (OCoLC)1055339519 \|z (OCoLC)1066437127 \|z (OCoLC)1081227355 \|z (OCoLC)1228539146
050		4	\|a T174.7 \|b .F76 2012eb
072		7	\|a SCI \|x 050000 \|2 bisacsh
072		7	\|a TEC \|x 027000 \|2 bisacsh
082	7		\|a 620/.5 \|2 23
049			\|a MAIN
111	2		\|a International Conference on Frontiers of Nanoscience and Technology \|n (2nd : \|d 2012 : \|c Hong Kong, China) \|0 http://id.loc.gov/authorities/names/no2013021707
245	1	0	\|a Frontier of Nanoscience and Technology II : \|b selected, peer reviewed papers from the 2012 International Conference on Frontiers of Nanoscience and Technology (ICFNST 2012), July 26-27, 2012, Hongkong / \|c edited by Jimmy (C.M.) Kao, Meng Hou and Ran Chen.
260			\|a Durnten-Zurich, Switzerland ; \|a Enfield, NH : \|b Trans Tech Publications, \|c ©2012.
264		4	\|c ©2012
300			\|a 1 online resource (x, 291 pages) : \|b illustrations (some color)
336			\|a text \|b txt \|2 rdacontent
337			\|a computer \|b c \|2 rdamedia
338			\|a online resource \|b cr \|2 rdacarrier
490	1		\|a Advanced materials research, \|x 1022-6680 ; \|v v. 528
504			\|a Includes bibliographical references and index.
588	0		\|a Print version record.
520			\|a This book comprises 62 peer-reviewed papers on the topics of Nanoscience and Materials Technology, and has the aim of promoting the development of Nanoscience and Materials Technology, strengthening international academic cooperation and communications and exchanging research ideas. This work provides readers with a broad overview of the latest advances in the field of Nanoscience and Materials Technology. Kao (National Sun Yat-Sen U., Taiwan) et al. collect 62 papers from the 2012 International Conference on Frontiers of Nanoscience and Technology (ICFNST 2012), held in July in Hong Kong. Researchers, engineers, academics, and industry professionals mainly from Asia present research results and development activities in nanoscience and technology, including nanoparticle manufacturing, mechanical properties, the design and fabrication, development, preparation and characterization, manufacturing processes, polymerization, nanostructure, performance, and materials engineering of various materials, such as aluminum thin films, capsaicin injectable gels, lithium-ion batteries, starch, Nifeviroc-loaded microemulsions, and nanowires.
505	0		\|a Frontier of Nanoscience and Technology II; Preface, Committees and Sponsors; Table of Contents; Chapter 1: Nanoscience; A Control System Design for Nanoparticle Manufacturing by Using Im-Pinging-Jet Micromixers; Development of Anodic Titanium Oxide Nanotubes Applied to a pH Sensor with Amperometric and Potentioimetric Methods; Compressive Mechanical Properties of Carbon Nanotube Sponges: Experiments and Modeling; Design and Fabrication of Micropump Actuated by Laser Shock Wave; Design and Fabrication of Thermocapillary Micro Bubble Pump
505	8		\|a Development of Nano-TiO2 Coating on Titanium Alloy Substrate for Biomedical ApplicationsPreparation and Characterization of Attapulgite-KH550 Nanocomposites and their Application to Methane Absorption; Preparation and Characterization of Cellulose Nanowhiskers in N, N-Dimethylacetamide; Preparation and Characterization of Chitosan-Poly(MA-PEG400-SA) Nanoparticles as Drug Carrier; Preparation and Hydrogen Storage Kinetics of Nanocrystalline and Amorphous Mg20Ni10-xMx (M=Co, Cu; x=0-4) Alloys; Preparation and Properties of Gd and Sb Doped SnO2 Conductive Nanoparticles
505	8		\|a Preparation of Cortex Moutan Nanoparticles and its Microscopic Characteristics and Physicochemical PropertiesPreparation of Liuweidihuang Nano-Microcapsules and its Physicochemical Properties; Process for Manufacturing Multi-Functional Nano-TiO2 Composite Powder; Removing of Nano-Particles from Semiconductor Wastewater Using a Hybrid Treatment System; Resonance Suppression on Nanoscale Viscoelasticity Measurement; Cellular Uptake of PEGylated PLGA Nanoparticles in Hela Cells; A Fabrication Study on Diode FED Panel Utilizing Improved Film-Electrode; Chapter 2: Materials Engineering
505	8		\|a A Computational Study on Structures, Stabilities and Electronic Properties of Trifluoromethyl Silsesquioxanes Si2nO3n(CF3)2n (n=1-5)AFM Interaction Forces of Lubricity Materials Surface; Adsorption Kinetics of Pb (II) onto Na-Bentonite/Poly AMPS Composite; Capsaicin Injectable In-Situ Forming Gels; Calcium Ion Treatment Behavior of Silk Fibroin/Sodium Alginate Scaffolds; Characteristics of Compression Wood Tracheid of Loblolly Pine Induced by Artificial Inclination; Controlled Synthesis and Upconversion Luminescence Properties of Yb3+-Tm3+ Codoped NaYF4 Hexagonal Submicroplates
505	8		\|a Dielectric Properties of Zr-Doped CCTO Based Ceramics Prepared via Sol-Gel MethodLi+ Extraction/Insertion Reaction with LiMnTi0.25O3 Spinel; Effect of Rare Earth on the Inclusions and Pitting Resistance of Duplex Stainless Steel; Effect of Temperatures on Tensile of Aluminium Thin Films; Film Properties of Poly(lactic Acid) Comprising N-Methyl-2-Pyrrolidone; Friction Welding of Zr41Ti14Cu12.5Ni10Be22.5 Bulk Metallic Glass and Temperature Field Simulation; Investigation of Precipitation in a Aging Hardened Plastic Mould Steel
650		0	\|a Nanotechnology \|v Congresses.
650		0	\|a Nanoscience \|v Congresses.
650		6	\|a Nanosciences \|v Congrès.
650		6	\|a Nanotechnologie \|v Congrès.
650		7	\|a SCIENCE \|x Nanoscience. \|2 bisacsh
650		7	\|a TECHNOLOGY & ENGINEERING \|x Nanotechnology & MEMS. \|2 bisacsh
650		7	\|a Nanoscience \|2 fast
650		7	\|a Nanotechnology \|2 fast
653	1		\|a Nanoscience
653	1		\|a ICFNST
655		7	\|a Conference papers and proceedings \|2 fast
700	1		\|a Kao, Jimmy C. M. \|q (Jimmy Chih-Ming), \|d 1963- \|e editor. \|1 https://id.oclc.org/worldcat/entity/E39PCjyGcMr6d4JJB3krRh4d6X \|0 http://id.loc.gov/authorities/names/no2013010213
700	1		\|a Hou, Meng, \|e editor.
700	1		\|a Chen, Ran, \|c (Mechanical engineer), \|e editor.
776	0	8	\|i Print version: \|a Frontier of Nanoscience and Technology (2nd : 2012 : Hongkong, China). \|t Frontier of Nanoscience and Technology II. \|d Durnten-Zurich, Switzerland ; Enfield, NH : Trans Tech Publications, ©2012 \|z 9783037854297 \|w (OCoLC)811728500
830		0	\|a Advanced materials research ; \|v v. 528. \|0 http://id.loc.gov/authorities/names/n99255722
966	4	0	\|l DE-862 \|p ZDB-4-EBA \|q FWS_PDA_EBA \|u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=517235 \|3 Volltext
966	4	0	\|l DE-863 \|p ZDB-4-EBA \|q FWS_PDA_EBA \|u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=517235 \|3 Volltext
938			\|a Trans Tech Publications, Ltd \|b TRAN \|n 10.4028/www.scientific.net/AMR.528
938			\|a EBL - Ebook Library \|b EBLB \|n EBL1872874
938			\|a ebrary \|b EBRY \|n ebr10828251
938			\|a EBSCOhost \|b EBSC \|n 517235
938			\|a YBP Library Services \|b YANK \|n 9968200
994			\|a 92 \|b GEBAY
912			\|a ZDB-4-EBA
049			\|a DE-862
049			\|a DE-863

Datensatz im Suchindex

DE-BY-FWS_katkey	ZDB-4-EBA-ocn827788098
_version_	1829094949115658240
adam_text
any_adam_object
author2	Kao, Jimmy C. M. (Jimmy Chih-Ming), 1963- Hou, Meng Chen, Ran, (Mechanical engineer)
author2_role	edt edt edt
author2_variant	j c m k jcm jcmk m h mh r c rc
author_GND	http://id.loc.gov/authorities/names/no2013010213
author_corporate	International Conference on Frontiers of Nanoscience and Technology Hong Kong, China
author_corporate_role
author_facet	Kao, Jimmy C. M. (Jimmy Chih-Ming), 1963- Hou, Meng Chen, Ran, (Mechanical engineer) International Conference on Frontiers of Nanoscience and Technology Hong Kong, China
author_sort	International Conference on Frontiers of Nanoscience and Technology Hong Kong, China
building	Verbundindex
bvnumber	localFWS
callnumber-first	T - Technology
callnumber-label	T174
callnumber-raw	T174.7 .F76 2012eb
callnumber-search	T174.7 .F76 2012eb
callnumber-sort	T 3174.7 F76 42012EB
callnumber-subject	T - General Technology
collection	ZDB-4-EBA
contents	Frontier of Nanoscience and Technology II; Preface, Committees and Sponsors; Table of Contents; Chapter 1: Nanoscience; A Control System Design for Nanoparticle Manufacturing by Using Im-Pinging-Jet Micromixers; Development of Anodic Titanium Oxide Nanotubes Applied to a pH Sensor with Amperometric and Potentioimetric Methods; Compressive Mechanical Properties of Carbon Nanotube Sponges: Experiments and Modeling; Design and Fabrication of Micropump Actuated by Laser Shock Wave; Design and Fabrication of Thermocapillary Micro Bubble Pump Development of Nano-TiO2 Coating on Titanium Alloy Substrate for Biomedical ApplicationsPreparation and Characterization of Attapulgite-KH550 Nanocomposites and their Application to Methane Absorption; Preparation and Characterization of Cellulose Nanowhiskers in N, N-Dimethylacetamide; Preparation and Characterization of Chitosan-Poly(MA-PEG400-SA) Nanoparticles as Drug Carrier; Preparation and Hydrogen Storage Kinetics of Nanocrystalline and Amorphous Mg20Ni10-xMx (M=Co, Cu; x=0-4) Alloys; Preparation and Properties of Gd and Sb Doped SnO2 Conductive Nanoparticles Preparation of Cortex Moutan Nanoparticles and its Microscopic Characteristics and Physicochemical PropertiesPreparation of Liuweidihuang Nano-Microcapsules and its Physicochemical Properties; Process for Manufacturing Multi-Functional Nano-TiO2 Composite Powder; Removing of Nano-Particles from Semiconductor Wastewater Using a Hybrid Treatment System; Resonance Suppression on Nanoscale Viscoelasticity Measurement; Cellular Uptake of PEGylated PLGA Nanoparticles in Hela Cells; A Fabrication Study on Diode FED Panel Utilizing Improved Film-Electrode; Chapter 2: Materials Engineering A Computational Study on Structures, Stabilities and Electronic Properties of Trifluoromethyl Silsesquioxanes Si2nO3n(CF3)2n (n=1-5)AFM Interaction Forces of Lubricity Materials Surface; Adsorption Kinetics of Pb (II) onto Na-Bentonite/Poly AMPS Composite; Capsaicin Injectable In-Situ Forming Gels; Calcium Ion Treatment Behavior of Silk Fibroin/Sodium Alginate Scaffolds; Characteristics of Compression Wood Tracheid of Loblolly Pine Induced by Artificial Inclination; Controlled Synthesis and Upconversion Luminescence Properties of Yb3+-Tm3+ Codoped NaYF4 Hexagonal Submicroplates Dielectric Properties of Zr-Doped CCTO Based Ceramics Prepared via Sol-Gel MethodLi+ Extraction/Insertion Reaction with LiMnTi0.25O3 Spinel; Effect of Rare Earth on the Inclusions and Pitting Resistance of Duplex Stainless Steel; Effect of Temperatures on Tensile of Aluminium Thin Films; Film Properties of Poly(lactic Acid) Comprising N-Methyl-2-Pyrrolidone; Friction Welding of Zr41Ti14Cu12.5Ni10Be22.5 Bulk Metallic Glass and Temperature Field Simulation; Investigation of Precipitation in a Aging Hardened Plastic Mould Steel
ctrlnum	(OCoLC)827788098
dewey-full	620/.5
dewey-hundreds	600 - Technology (Applied sciences)
dewey-ones	620 - Engineering and allied operations
dewey-raw	620/.5
dewey-search	620/.5
dewey-sort	3620 15
dewey-tens	620 - Engineering and allied operations
format	Electronic Conference Proceeding eBook
fullrecord	<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>07693cam a2200745 a 4500</leader><controlfield tag="001">ZDB-4-EBA-ocn827788098</controlfield><controlfield tag="003">OCoLC</controlfield><controlfield tag="005">20250103110447.0</controlfield><controlfield tag="006">m o d </controlfield><controlfield tag="007">cr cnu---unuuu</controlfield><controlfield tag="008">130215s2012 sz a ob 101 0 eng d</controlfield><datafield tag="010" ind1=" " ind2=" "><subfield code="a"> 2012382029</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">N$T</subfield><subfield code="b">eng</subfield><subfield code="e">pn</subfield><subfield code="c">N$T</subfield><subfield code="d">MUU</subfield><subfield code="d">WAU</subfield><subfield code="d">OKU</subfield><subfield code="d">CUS</subfield><subfield code="d">YDXCP</subfield><subfield code="d">OCLCF</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">E7B</subfield><subfield code="d">EBLCP</subfield><subfield code="d">DEBSZ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">LLB</subfield><subfield code="d">OCL</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">COCUF</subfield><subfield code="d">AGLDB</subfield><subfield code="d">MOR</subfield><subfield code="d">CCO</subfield><subfield code="d">PIFAG</subfield><subfield code="d">MERUC</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">ZCU</subfield><subfield code="d">U3W</subfield><subfield code="d">STF</subfield><subfield code="d">VTS</subfield><subfield code="d">NRAMU</subfield><subfield code="d">ICG</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">INT</subfield><subfield code="d">VT2</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">WYU</subfield><subfield code="d">TKN</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">DKC</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">M8D</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">HS0</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">TTECH</subfield><subfield code="d">AJS</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCL</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCL</subfield><subfield code="d">OCLCQ</subfield></datafield><datafield tag="016" ind1="7" ind2=" "><subfield code="a">016171451</subfield><subfield code="2">Uk</subfield></datafield><datafield tag="019" ind1=" " ind2=" "><subfield code="a">812546991</subfield><subfield code="a">872666879</subfield><subfield code="a">961579951</subfield><subfield code="a">1055339519</subfield><subfield code="a">1066437127</subfield><subfield code="a">1081227355</subfield><subfield code="a">1228539146</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038138433</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3038138436</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">9783037854297</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">3037854294</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)827788098</subfield><subfield code="z">(OCoLC)812546991</subfield><subfield code="z">(OCoLC)872666879</subfield><subfield code="z">(OCoLC)961579951</subfield><subfield code="z">(OCoLC)1055339519</subfield><subfield code="z">(OCoLC)1066437127</subfield><subfield code="z">(OCoLC)1081227355</subfield><subfield code="z">(OCoLC)1228539146</subfield></datafield><datafield tag="050" ind1=" " ind2="4"><subfield code="a">T174.7</subfield><subfield code="b">.F76 2012eb</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">SCI</subfield><subfield code="x">050000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">TEC</subfield><subfield code="x">027000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="082" ind1="7" ind2=" "><subfield code="a">620/.5</subfield><subfield code="2">23</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">MAIN</subfield></datafield><datafield tag="111" ind1="2" ind2=" "><subfield code="a">International Conference on Frontiers of Nanoscience and Technology</subfield><subfield code="n">(2nd :</subfield><subfield code="d">2012 :</subfield><subfield code="c">Hong Kong, China)</subfield><subfield code="0">http://id.loc.gov/authorities/names/no2013021707</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Frontier of Nanoscience and Technology II :</subfield><subfield code="b">selected, peer reviewed papers from the 2012 International Conference on Frontiers of Nanoscience and Technology (ICFNST 2012), July 26-27, 2012, Hongkong /</subfield><subfield code="c">edited by Jimmy (C.M.) Kao, Meng Hou and Ran Chen.</subfield></datafield><datafield tag="260" ind1=" " ind2=" "><subfield code="a">Durnten-Zurich, Switzerland ;</subfield><subfield code="a">Enfield, NH :</subfield><subfield code="b">Trans Tech Publications,</subfield><subfield code="c">©2012.</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">©2012</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (x, 291 pages) :</subfield><subfield code="b">illustrations (some color)</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">computer</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">online resource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Advanced materials research,</subfield><subfield code="x">1022-6680 ;</subfield><subfield code="v">v. 528</subfield></datafield><datafield tag="504" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references and index.</subfield></datafield><datafield tag="588" ind1="0" ind2=" "><subfield code="a">Print version record.</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">This book comprises 62 peer-reviewed papers on the topics of Nanoscience and Materials Technology, and has the aim of promoting the development of Nanoscience and Materials Technology, strengthening international academic cooperation and communications and exchanging research ideas. This work provides readers with a broad overview of the latest advances in the field of Nanoscience and Materials Technology. Kao (National Sun Yat-Sen U., Taiwan) et al. collect 62 papers from the 2012 International Conference on Frontiers of Nanoscience and Technology (ICFNST 2012), held in July in Hong Kong. Researchers, engineers, academics, and industry professionals mainly from Asia present research results and development activities in nanoscience and technology, including nanoparticle manufacturing, mechanical properties, the design and fabrication, development, preparation and characterization, manufacturing processes, polymerization, nanostructure, performance, and materials engineering of various materials, such as aluminum thin films, capsaicin injectable gels, lithium-ion batteries, starch, Nifeviroc-loaded microemulsions, and nanowires.</subfield></datafield><datafield tag="505" ind1="0" ind2=" "><subfield code="a">Frontier of Nanoscience and Technology II; Preface, Committees and Sponsors; Table of Contents; Chapter 1: Nanoscience; A Control System Design for Nanoparticle Manufacturing by Using Im-Pinging-Jet Micromixers; Development of Anodic Titanium Oxide Nanotubes Applied to a pH Sensor with Amperometric and Potentioimetric Methods; Compressive Mechanical Properties of Carbon Nanotube Sponges: Experiments and Modeling; Design and Fabrication of Micropump Actuated by Laser Shock Wave; Design and Fabrication of Thermocapillary Micro Bubble Pump</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Development of Nano-TiO2 Coating on Titanium Alloy Substrate for Biomedical ApplicationsPreparation and Characterization of Attapulgite-KH550 Nanocomposites and their Application to Methane Absorption; Preparation and Characterization of Cellulose Nanowhiskers in N, N-Dimethylacetamide; Preparation and Characterization of Chitosan-Poly(MA-PEG400-SA) Nanoparticles as Drug Carrier; Preparation and Hydrogen Storage Kinetics of Nanocrystalline and Amorphous Mg20Ni10-xMx (M=Co, Cu; x=0-4) Alloys; Preparation and Properties of Gd and Sb Doped SnO2 Conductive Nanoparticles</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Preparation of Cortex Moutan Nanoparticles and its Microscopic Characteristics and Physicochemical PropertiesPreparation of Liuweidihuang Nano-Microcapsules and its Physicochemical Properties; Process for Manufacturing Multi-Functional Nano-TiO2 Composite Powder; Removing of Nano-Particles from Semiconductor Wastewater Using a Hybrid Treatment System; Resonance Suppression on Nanoscale Viscoelasticity Measurement; Cellular Uptake of PEGylated PLGA Nanoparticles in Hela Cells; A Fabrication Study on Diode FED Panel Utilizing Improved Film-Electrode; Chapter 2: Materials Engineering</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">A Computational Study on Structures, Stabilities and Electronic Properties of Trifluoromethyl Silsesquioxanes Si2nO3n(CF3)2n (n=1-5)AFM Interaction Forces of Lubricity Materials Surface; Adsorption Kinetics of Pb (II) onto Na-Bentonite/Poly AMPS Composite; Capsaicin Injectable In-Situ Forming Gels; Calcium Ion Treatment Behavior of Silk Fibroin/Sodium Alginate Scaffolds; Characteristics of Compression Wood Tracheid of Loblolly Pine Induced by Artificial Inclination; Controlled Synthesis and Upconversion Luminescence Properties of Yb3+-Tm3+ Codoped NaYF4 Hexagonal Submicroplates</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Dielectric Properties of Zr-Doped CCTO Based Ceramics Prepared via Sol-Gel MethodLi+ Extraction/Insertion Reaction with LiMnTi0.25O3 Spinel; Effect of Rare Earth on the Inclusions and Pitting Resistance of Duplex Stainless Steel; Effect of Temperatures on Tensile of Aluminium Thin Films; Film Properties of Poly(lactic Acid) Comprising N-Methyl-2-Pyrrolidone; Friction Welding of Zr41Ti14Cu12.5Ni10Be22.5 Bulk Metallic Glass and Temperature Field Simulation; Investigation of Precipitation in a Aging Hardened Plastic Mould Steel</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Nanotechnology</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Nanoscience</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Nanosciences</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Nanotechnologie</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">SCIENCE</subfield><subfield code="x">Nanoscience.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING</subfield><subfield code="x">Nanotechnology & MEMS.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Nanoscience</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Nanotechnology</subfield><subfield code="2">fast</subfield></datafield><datafield tag="653" ind1="1" ind2=" "><subfield code="a">Nanoscience</subfield></datafield><datafield tag="653" ind1="1" ind2=" "><subfield code="a">ICFNST</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">Conference papers and proceedings</subfield><subfield code="2">fast</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Kao, Jimmy C. M.</subfield><subfield code="q">(Jimmy Chih-Ming),</subfield><subfield code="d">1963-</subfield><subfield code="e">editor.</subfield><subfield code="1">https://id.oclc.org/worldcat/entity/E39PCjyGcMr6d4JJB3krRh4d6X</subfield><subfield code="0">http://id.loc.gov/authorities/names/no2013010213</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Hou, Meng,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Chen, Ran,</subfield><subfield code="c">(Mechanical engineer),</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Print version:</subfield><subfield code="a">Frontier of Nanoscience and Technology (2nd : 2012 : Hongkong, China).</subfield><subfield code="t">Frontier of Nanoscience and Technology II.</subfield><subfield code="d">Durnten-Zurich, Switzerland ; Enfield, NH : Trans Tech Publications, ©2012</subfield><subfield code="z">9783037854297</subfield><subfield code="w">(OCoLC)811728500</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Advanced materials research ;</subfield><subfield code="v">v. 528.</subfield><subfield code="0">http://id.loc.gov/authorities/names/n99255722</subfield></datafield><datafield tag="966" ind1="4" ind2="0"><subfield code="l">DE-862</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=517235</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="4" ind2="0"><subfield code="l">DE-863</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=517235</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">Trans Tech Publications, Ltd</subfield><subfield code="b">TRAN</subfield><subfield code="n">10.4028/www.scientific.net/AMR.528</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">EBL - Ebook Library</subfield><subfield code="b">EBLB</subfield><subfield code="n">EBL1872874</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">ebrary</subfield><subfield code="b">EBRY</subfield><subfield code="n">ebr10828251</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">EBSCOhost</subfield><subfield code="b">EBSC</subfield><subfield code="n">517235</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">YBP Library Services</subfield><subfield code="b">YANK</subfield><subfield code="n">9968200</subfield></datafield><datafield tag="994" ind1=" " ind2=" "><subfield code="a">92</subfield><subfield code="b">GEBAY</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-862</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-863</subfield></datafield></record></collection>
genre	Conference papers and proceedings fast
genre_facet	Conference papers and proceedings
id	ZDB-4-EBA-ocn827788098
illustrated	Illustrated
indexdate	2025-04-11T08:41:15Z
institution	BVB
institution_GND	http://id.loc.gov/authorities/names/no2013021707
isbn	9783038138433 3038138436
issn	1022-6680 ;
language	English
lccn	2012382029
oclc_num	827788098
open_access_boolean
owner	MAIN DE-862 DE-BY-FWS DE-863 DE-BY-FWS
owner_facet	MAIN DE-862 DE-BY-FWS DE-863 DE-BY-FWS
physical	1 online resource (x, 291 pages) : illustrations (some color)
psigel	ZDB-4-EBA FWS_PDA_EBA ZDB-4-EBA
publishDate	2012
publishDateSearch	2012
publishDateSort	2012
publisher	Trans Tech Publications,
record_format	marc
series	Advanced materials research ;
series2	Advanced materials research,
spelling	International Conference on Frontiers of Nanoscience and Technology (2nd : 2012 : Hong Kong, China) http://id.loc.gov/authorities/names/no2013021707 Frontier of Nanoscience and Technology II : selected, peer reviewed papers from the 2012 International Conference on Frontiers of Nanoscience and Technology (ICFNST 2012), July 26-27, 2012, Hongkong / edited by Jimmy (C.M.) Kao, Meng Hou and Ran Chen. Durnten-Zurich, Switzerland ; Enfield, NH : Trans Tech Publications, ©2012. ©2012 1 online resource (x, 291 pages) : illustrations (some color) text txt rdacontent computer c rdamedia online resource cr rdacarrier Advanced materials research, 1022-6680 ; v. 528 Includes bibliographical references and index. Print version record. This book comprises 62 peer-reviewed papers on the topics of Nanoscience and Materials Technology, and has the aim of promoting the development of Nanoscience and Materials Technology, strengthening international academic cooperation and communications and exchanging research ideas. This work provides readers with a broad overview of the latest advances in the field of Nanoscience and Materials Technology. Kao (National Sun Yat-Sen U., Taiwan) et al. collect 62 papers from the 2012 International Conference on Frontiers of Nanoscience and Technology (ICFNST 2012), held in July in Hong Kong. Researchers, engineers, academics, and industry professionals mainly from Asia present research results and development activities in nanoscience and technology, including nanoparticle manufacturing, mechanical properties, the design and fabrication, development, preparation and characterization, manufacturing processes, polymerization, nanostructure, performance, and materials engineering of various materials, such as aluminum thin films, capsaicin injectable gels, lithium-ion batteries, starch, Nifeviroc-loaded microemulsions, and nanowires. Frontier of Nanoscience and Technology II; Preface, Committees and Sponsors; Table of Contents; Chapter 1: Nanoscience; A Control System Design for Nanoparticle Manufacturing by Using Im-Pinging-Jet Micromixers; Development of Anodic Titanium Oxide Nanotubes Applied to a pH Sensor with Amperometric and Potentioimetric Methods; Compressive Mechanical Properties of Carbon Nanotube Sponges: Experiments and Modeling; Design and Fabrication of Micropump Actuated by Laser Shock Wave; Design and Fabrication of Thermocapillary Micro Bubble Pump Development of Nano-TiO2 Coating on Titanium Alloy Substrate for Biomedical ApplicationsPreparation and Characterization of Attapulgite-KH550 Nanocomposites and their Application to Methane Absorption; Preparation and Characterization of Cellulose Nanowhiskers in N, N-Dimethylacetamide; Preparation and Characterization of Chitosan-Poly(MA-PEG400-SA) Nanoparticles as Drug Carrier; Preparation and Hydrogen Storage Kinetics of Nanocrystalline and Amorphous Mg20Ni10-xMx (M=Co, Cu; x=0-4) Alloys; Preparation and Properties of Gd and Sb Doped SnO2 Conductive Nanoparticles Preparation of Cortex Moutan Nanoparticles and its Microscopic Characteristics and Physicochemical PropertiesPreparation of Liuweidihuang Nano-Microcapsules and its Physicochemical Properties; Process for Manufacturing Multi-Functional Nano-TiO2 Composite Powder; Removing of Nano-Particles from Semiconductor Wastewater Using a Hybrid Treatment System; Resonance Suppression on Nanoscale Viscoelasticity Measurement; Cellular Uptake of PEGylated PLGA Nanoparticles in Hela Cells; A Fabrication Study on Diode FED Panel Utilizing Improved Film-Electrode; Chapter 2: Materials Engineering A Computational Study on Structures, Stabilities and Electronic Properties of Trifluoromethyl Silsesquioxanes Si2nO3n(CF3)2n (n=1-5)AFM Interaction Forces of Lubricity Materials Surface; Adsorption Kinetics of Pb (II) onto Na-Bentonite/Poly AMPS Composite; Capsaicin Injectable In-Situ Forming Gels; Calcium Ion Treatment Behavior of Silk Fibroin/Sodium Alginate Scaffolds; Characteristics of Compression Wood Tracheid of Loblolly Pine Induced by Artificial Inclination; Controlled Synthesis and Upconversion Luminescence Properties of Yb3+-Tm3+ Codoped NaYF4 Hexagonal Submicroplates Dielectric Properties of Zr-Doped CCTO Based Ceramics Prepared via Sol-Gel MethodLi+ Extraction/Insertion Reaction with LiMnTi0.25O3 Spinel; Effect of Rare Earth on the Inclusions and Pitting Resistance of Duplex Stainless Steel; Effect of Temperatures on Tensile of Aluminium Thin Films; Film Properties of Poly(lactic Acid) Comprising N-Methyl-2-Pyrrolidone; Friction Welding of Zr41Ti14Cu12.5Ni10Be22.5 Bulk Metallic Glass and Temperature Field Simulation; Investigation of Precipitation in a Aging Hardened Plastic Mould Steel Nanotechnology Congresses. Nanoscience Congresses. Nanosciences Congrès. Nanotechnologie Congrès. SCIENCE Nanoscience. bisacsh TECHNOLOGY & ENGINEERING Nanotechnology & MEMS. bisacsh Nanoscience fast Nanotechnology fast Nanoscience ICFNST Conference papers and proceedings fast Kao, Jimmy C. M. (Jimmy Chih-Ming), 1963- editor. https://id.oclc.org/worldcat/entity/E39PCjyGcMr6d4JJB3krRh4d6X http://id.loc.gov/authorities/names/no2013010213 Hou, Meng, editor. Chen, Ran, (Mechanical engineer), editor. Print version: Frontier of Nanoscience and Technology (2nd : 2012 : Hongkong, China). Frontier of Nanoscience and Technology II. Durnten-Zurich, Switzerland ; Enfield, NH : Trans Tech Publications, ©2012 9783037854297 (OCoLC)811728500 Advanced materials research ; v. 528. http://id.loc.gov/authorities/names/n99255722
spellingShingle	Frontier of Nanoscience and Technology II : selected, peer reviewed papers from the 2012 International Conference on Frontiers of Nanoscience and Technology (ICFNST 2012), July 26-27, 2012, Hongkong / Advanced materials research ; Frontier of Nanoscience and Technology II; Preface, Committees and Sponsors; Table of Contents; Chapter 1: Nanoscience; A Control System Design for Nanoparticle Manufacturing by Using Im-Pinging-Jet Micromixers; Development of Anodic Titanium Oxide Nanotubes Applied to a pH Sensor with Amperometric and Potentioimetric Methods; Compressive Mechanical Properties of Carbon Nanotube Sponges: Experiments and Modeling; Design and Fabrication of Micropump Actuated by Laser Shock Wave; Design and Fabrication of Thermocapillary Micro Bubble Pump Development of Nano-TiO2 Coating on Titanium Alloy Substrate for Biomedical ApplicationsPreparation and Characterization of Attapulgite-KH550 Nanocomposites and their Application to Methane Absorption; Preparation and Characterization of Cellulose Nanowhiskers in N, N-Dimethylacetamide; Preparation and Characterization of Chitosan-Poly(MA-PEG400-SA) Nanoparticles as Drug Carrier; Preparation and Hydrogen Storage Kinetics of Nanocrystalline and Amorphous Mg20Ni10-xMx (M=Co, Cu; x=0-4) Alloys; Preparation and Properties of Gd and Sb Doped SnO2 Conductive Nanoparticles Preparation of Cortex Moutan Nanoparticles and its Microscopic Characteristics and Physicochemical PropertiesPreparation of Liuweidihuang Nano-Microcapsules and its Physicochemical Properties; Process for Manufacturing Multi-Functional Nano-TiO2 Composite Powder; Removing of Nano-Particles from Semiconductor Wastewater Using a Hybrid Treatment System; Resonance Suppression on Nanoscale Viscoelasticity Measurement; Cellular Uptake of PEGylated PLGA Nanoparticles in Hela Cells; A Fabrication Study on Diode FED Panel Utilizing Improved Film-Electrode; Chapter 2: Materials Engineering A Computational Study on Structures, Stabilities and Electronic Properties of Trifluoromethyl Silsesquioxanes Si2nO3n(CF3)2n (n=1-5)AFM Interaction Forces of Lubricity Materials Surface; Adsorption Kinetics of Pb (II) onto Na-Bentonite/Poly AMPS Composite; Capsaicin Injectable In-Situ Forming Gels; Calcium Ion Treatment Behavior of Silk Fibroin/Sodium Alginate Scaffolds; Characteristics of Compression Wood Tracheid of Loblolly Pine Induced by Artificial Inclination; Controlled Synthesis and Upconversion Luminescence Properties of Yb3+-Tm3+ Codoped NaYF4 Hexagonal Submicroplates Dielectric Properties of Zr-Doped CCTO Based Ceramics Prepared via Sol-Gel MethodLi+ Extraction/Insertion Reaction with LiMnTi0.25O3 Spinel; Effect of Rare Earth on the Inclusions and Pitting Resistance of Duplex Stainless Steel; Effect of Temperatures on Tensile of Aluminium Thin Films; Film Properties of Poly(lactic Acid) Comprising N-Methyl-2-Pyrrolidone; Friction Welding of Zr41Ti14Cu12.5Ni10Be22.5 Bulk Metallic Glass and Temperature Field Simulation; Investigation of Precipitation in a Aging Hardened Plastic Mould Steel Nanotechnology Congresses. Nanoscience Congresses. Nanosciences Congrès. Nanotechnologie Congrès. SCIENCE Nanoscience. bisacsh TECHNOLOGY & ENGINEERING Nanotechnology & MEMS. bisacsh Nanoscience fast Nanotechnology fast
title	Frontier of Nanoscience and Technology II : selected, peer reviewed papers from the 2012 International Conference on Frontiers of Nanoscience and Technology (ICFNST 2012), July 26-27, 2012, Hongkong /
title_auth	Frontier of Nanoscience and Technology II : selected, peer reviewed papers from the 2012 International Conference on Frontiers of Nanoscience and Technology (ICFNST 2012), July 26-27, 2012, Hongkong /
title_exact_search	Frontier of Nanoscience and Technology II : selected, peer reviewed papers from the 2012 International Conference on Frontiers of Nanoscience and Technology (ICFNST 2012), July 26-27, 2012, Hongkong /
title_full	Frontier of Nanoscience and Technology II : selected, peer reviewed papers from the 2012 International Conference on Frontiers of Nanoscience and Technology (ICFNST 2012), July 26-27, 2012, Hongkong / edited by Jimmy (C.M.) Kao, Meng Hou and Ran Chen.
title_fullStr	Frontier of Nanoscience and Technology II : selected, peer reviewed papers from the 2012 International Conference on Frontiers of Nanoscience and Technology (ICFNST 2012), July 26-27, 2012, Hongkong / edited by Jimmy (C.M.) Kao, Meng Hou and Ran Chen.
title_full_unstemmed	Frontier of Nanoscience and Technology II : selected, peer reviewed papers from the 2012 International Conference on Frontiers of Nanoscience and Technology (ICFNST 2012), July 26-27, 2012, Hongkong / edited by Jimmy (C.M.) Kao, Meng Hou and Ran Chen.
title_short	Frontier of Nanoscience and Technology II :
title_sort	frontier of nanoscience and technology ii selected peer reviewed papers from the 2012 international conference on frontiers of nanoscience and technology icfnst 2012 july 26 27 2012 hongkong
title_sub	selected, peer reviewed papers from the 2012 International Conference on Frontiers of Nanoscience and Technology (ICFNST 2012), July 26-27, 2012, Hongkong /
topic	Nanotechnology Congresses. Nanoscience Congresses. Nanosciences Congrès. Nanotechnologie Congrès. SCIENCE Nanoscience. bisacsh TECHNOLOGY & ENGINEERING Nanotechnology & MEMS. bisacsh Nanoscience fast Nanotechnology fast
topic_facet	Nanotechnology Congresses. Nanoscience Congresses. Nanosciences Congrès. Nanotechnologie Congrès. SCIENCE Nanoscience. TECHNOLOGY & ENGINEERING Nanotechnology & MEMS. Nanoscience Nanotechnology Conference papers and proceedings
work_keys_str_mv	AT internationalconferenceonfrontiersofnanoscienceandtechnologyhongkongchina frontierofnanoscienceandtechnologyiiselectedpeerreviewedpapersfromthe2012internationalconferenceonfrontiersofnanoscienceandtechnologyicfnst2012july26272012hongkong AT kaojimmycm frontierofnanoscienceandtechnologyiiselectedpeerreviewedpapersfromthe2012internationalconferenceonfrontiersofnanoscienceandtechnologyicfnst2012july26272012hongkong AT houmeng frontierofnanoscienceandtechnologyiiselectedpeerreviewedpapersfromthe2012internationalconferenceonfrontiersofnanoscienceandtechnologyicfnst2012july26272012hongkong AT chenran frontierofnanoscienceandtechnologyiiselectedpeerreviewedpapersfromthe2012internationalconferenceonfrontiersofnanoscienceandtechnologyicfnst2012july26272012hongkong

Verfügbarkeit

Es ist kein Print-Exemplar vorhanden.

Volltext öffnen

MARC

Datensatz im Suchindex

Es ist kein Print-Exemplar vorhanden.

Ähnliche Einträge