Elements of a neurobiological theory of the hippocampus :: the role of activity-dependent synaptic plasticity in memory /
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Elektronisch E-Book |
| Sprache: | English |
| Veröffentlicht: |
Amsterdam :
Vossiuspers UvA,
©2005.
|
| Schlagworte: | |
| Online-Zugang: | Volltext |
| Beschreibung: | "2004 Frijda Lecture, Cognitive Science Center, Amsterdam." |
| Beschreibung: | 1 online resource (41 pages) |
| Bibliographie: | Includes bibliographical references (pages 34-41). |
| ISBN: | 9781441610348 1441610340 |
Internformat
MARC
| LEADER | 00000cam a2200000 a 4500 | ||
|---|---|---|---|
| 001 | ZDB-4-EBA-ocn435447325 | ||
| 003 | OCoLC | ||
| 005 | 20241004212047.0 | ||
| 006 | m o d | ||
| 007 | cr cnu---unuuu | ||
| 008 | 090901s2005 ne ob 000 0 eng d | ||
| 040 | |a N$T |b eng |e pn |c N$T |d OCLCQ |d OCLCF |d NLGGC |d YDXCP |d CUS |d OCLCQ |d AGLDB |d OCLCQ |d VTS |d STF |d M8D |d OCLCO |d OCLCQ |d OCLCO |d OCLCL | ||
| 020 | |a 9781441610348 |q (electronic bk.) | ||
| 020 | |a 1441610340 |q (electronic bk.) | ||
| 035 | |a (OCoLC)435447325 | ||
| 050 | 4 | |a QP383.25 |b .M67 2005eb | |
| 072 | 7 | |a SOC |x 002020 |2 bisacsh | |
| 082 | 7 | |a 573.8/6 |2 22 | |
| 049 | |a MAIN | ||
| 100 | 1 | |a Morris, R. G. M. |q (Richard G. M.), |e author. |1 https://id.oclc.org/worldcat/entity/E39PBJhCF6gDDQcFWVjV9JfDv3 |0 http://id.loc.gov/authorities/names/n88185121 | |
| 245 | 1 | 0 | |a Elements of a neurobiological theory of the hippocampus : |b the role of activity-dependent synaptic plasticity in memory / |c R.G.M. Morris. |
| 260 | |a Amsterdam : |b Vossiuspers UvA, |c ©2005. | ||
| 300 | |a 1 online resource (41 pages) | ||
| 336 | |a text |b txt |2 rdacontent | ||
| 337 | |a computer |b c |2 rdamedia | ||
| 338 | |a online resource |b cr |2 rdacarrier | ||
| 500 | |a "2004 Frijda Lecture, Cognitive Science Center, Amsterdam." | ||
| 504 | |a Includes bibliographical references (pages 34-41). | ||
| 505 | 0 | |a The hippocampal formation and memory -- Elements of a neurobiological theory of the hippocampus and the role of NMDA receptor-dependent synaptic plasticity -- Experimental observations -- Conclusion -- References. | |
| 588 | 0 | |a Print version record. | |
| 650 | 0 | |a Hippocampus (Brain) |0 http://id.loc.gov/authorities/subjects/sh85060982 | |
| 650 | 0 | |a Memory. |0 http://id.loc.gov/authorities/subjects/sh85083497 | |
| 650 | 2 | |a Hippocampus |0 https://id.nlm.nih.gov/mesh/D006624 | |
| 650 | 6 | |a Hippocampe (Cerveau) | |
| 650 | 7 | |a SOCIAL SCIENCE |x Anthropology |x Physical. |2 bisacsh | |
| 650 | 7 | |a Hippocampus (Brain) |2 fast | |
| 650 | 7 | |a Memory |2 fast | |
| 758 | |i has work: |a Elements of a neurobiological theory of the hippocampus (Text) |1 https://id.oclc.org/worldcat/entity/E39PCGyJPKCMXk49tChPhHv7Md |4 https://id.oclc.org/worldcat/ontology/hasWork | ||
| 776 | 0 | 8 | |i Print version: |a Morris, R.G.M. (Richard G.M.). |t Elements of a neurobiological theory of the hippocampus. |d Amsterdam : Vossiuspers UvA, ©2005 |z 9789056293796 |
| 856 | 4 | 0 | |l FWS01 |p ZDB-4-EBA |q FWS_PDA_EBA |u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=158067 |3 Volltext |
| 938 | |a EBSCOhost |b EBSC |n 158067 | ||
| 938 | |a YBP Library Services |b YANK |n 3093881 | ||
| 994 | |a 92 |b GEBAY | ||
| 912 | |a ZDB-4-EBA | ||
| 049 | |a DE-863 | ||
Datensatz im Suchindex
| DE-BY-FWS_katkey | ZDB-4-EBA-ocn435447325 |
|---|---|
| _version_ | 1816881697246937088 |
| adam_text | |
| any_adam_object | |
| author | Morris, R. G. M. (Richard G. M.) |
| author_GND | http://id.loc.gov/authorities/names/n88185121 |
| author_facet | Morris, R. G. M. (Richard G. M.) |
| author_role | aut |
| author_sort | Morris, R. G. M. |
| author_variant | r g m m rgm rgmm |
| building | Verbundindex |
| bvnumber | localFWS |
| callnumber-first | Q - Science |
| callnumber-label | QP383 |
| callnumber-raw | QP383.25 .M67 2005eb |
| callnumber-search | QP383.25 .M67 2005eb |
| callnumber-sort | QP 3383.25 M67 42005EB |
| callnumber-subject | QP - Physiology |
| collection | ZDB-4-EBA |
| contents | The hippocampal formation and memory -- Elements of a neurobiological theory of the hippocampus and the role of NMDA receptor-dependent synaptic plasticity -- Experimental observations -- Conclusion -- References. |
| ctrlnum | (OCoLC)435447325 |
| dewey-full | 573.8/6 |
| dewey-hundreds | 500 - Natural sciences and mathematics |
| dewey-ones | 573 - Specific physiological systems in animals |
| dewey-raw | 573.8/6 |
| dewey-search | 573.8/6 |
| dewey-sort | 3573.8 16 |
| dewey-tens | 570 - Biology |
| discipline | Biologie |
| format | Electronic eBook |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>02540cam a2200481 a 4500</leader><controlfield tag="001">ZDB-4-EBA-ocn435447325</controlfield><controlfield tag="003">OCoLC</controlfield><controlfield tag="005">20241004212047.0</controlfield><controlfield tag="006">m o d </controlfield><controlfield tag="007">cr cnu---unuuu</controlfield><controlfield tag="008">090901s2005 ne ob 000 0 eng d</controlfield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">N$T</subfield><subfield code="b">eng</subfield><subfield code="e">pn</subfield><subfield code="c">N$T</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCF</subfield><subfield code="d">NLGGC</subfield><subfield code="d">YDXCP</subfield><subfield code="d">CUS</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">AGLDB</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">VTS</subfield><subfield code="d">STF</subfield><subfield code="d">M8D</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCL</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781441610348</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">1441610340</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)435447325</subfield></datafield><datafield tag="050" ind1=" " ind2="4"><subfield code="a">QP383.25</subfield><subfield code="b">.M67 2005eb</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">SOC</subfield><subfield code="x">002020</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="082" ind1="7" ind2=" "><subfield code="a">573.8/6</subfield><subfield code="2">22</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">MAIN</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Morris, R. G. M.</subfield><subfield code="q">(Richard G. M.),</subfield><subfield code="e">author.</subfield><subfield code="1">https://id.oclc.org/worldcat/entity/E39PBJhCF6gDDQcFWVjV9JfDv3</subfield><subfield code="0">http://id.loc.gov/authorities/names/n88185121</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Elements of a neurobiological theory of the hippocampus :</subfield><subfield code="b">the role of activity-dependent synaptic plasticity in memory /</subfield><subfield code="c">R.G.M. Morris.</subfield></datafield><datafield tag="260" ind1=" " ind2=" "><subfield code="a">Amsterdam :</subfield><subfield code="b">Vossiuspers UvA,</subfield><subfield code="c">©2005.</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (41 pages)</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">computer</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">online resource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">"2004 Frijda Lecture, Cognitive Science Center, Amsterdam."</subfield></datafield><datafield tag="504" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references (pages 34-41).</subfield></datafield><datafield tag="505" ind1="0" ind2=" "><subfield code="a">The hippocampal formation and memory -- Elements of a neurobiological theory of the hippocampus and the role of NMDA receptor-dependent synaptic plasticity -- Experimental observations -- Conclusion -- References.</subfield></datafield><datafield tag="588" ind1="0" ind2=" "><subfield code="a">Print version record.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Hippocampus (Brain)</subfield><subfield code="0">http://id.loc.gov/authorities/subjects/sh85060982</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Memory.</subfield><subfield code="0">http://id.loc.gov/authorities/subjects/sh85083497</subfield></datafield><datafield tag="650" ind1=" " ind2="2"><subfield code="a">Hippocampus</subfield><subfield code="0">https://id.nlm.nih.gov/mesh/D006624</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Hippocampe (Cerveau)</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">SOCIAL SCIENCE</subfield><subfield code="x">Anthropology</subfield><subfield code="x">Physical.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Hippocampus (Brain)</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Memory</subfield><subfield code="2">fast</subfield></datafield><datafield tag="758" ind1=" " ind2=" "><subfield code="i">has work:</subfield><subfield code="a">Elements of a neurobiological theory of the hippocampus (Text)</subfield><subfield code="1">https://id.oclc.org/worldcat/entity/E39PCGyJPKCMXk49tChPhHv7Md</subfield><subfield code="4">https://id.oclc.org/worldcat/ontology/hasWork</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Print version:</subfield><subfield code="a">Morris, R.G.M. (Richard G.M.).</subfield><subfield code="t">Elements of a neurobiological theory of the hippocampus.</subfield><subfield code="d">Amsterdam : Vossiuspers UvA, ©2005</subfield><subfield code="z">9789056293796</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="l">FWS01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=158067</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">EBSCOhost</subfield><subfield code="b">EBSC</subfield><subfield code="n">158067</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">YBP Library Services</subfield><subfield code="b">YANK</subfield><subfield code="n">3093881</subfield></datafield><datafield tag="994" ind1=" " ind2=" "><subfield code="a">92</subfield><subfield code="b">GEBAY</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-863</subfield></datafield></record></collection> |
| id | ZDB-4-EBA-ocn435447325 |
| illustrated | Not Illustrated |
| indexdate | 2024-11-27T13:16:50Z |
| institution | BVB |
| isbn | 9781441610348 1441610340 |
| language | English |
| oclc_num | 435447325 |
| open_access_boolean | |
| owner | MAIN DE-863 DE-BY-FWS |
| owner_facet | MAIN DE-863 DE-BY-FWS |
| physical | 1 online resource (41 pages) |
| psigel | ZDB-4-EBA |
| publishDate | 2005 |
| publishDateSearch | 2005 |
| publishDateSort | 2005 |
| publisher | Vossiuspers UvA, |
| record_format | marc |
| spelling | Morris, R. G. M. (Richard G. M.), author. https://id.oclc.org/worldcat/entity/E39PBJhCF6gDDQcFWVjV9JfDv3 http://id.loc.gov/authorities/names/n88185121 Elements of a neurobiological theory of the hippocampus : the role of activity-dependent synaptic plasticity in memory / R.G.M. Morris. Amsterdam : Vossiuspers UvA, ©2005. 1 online resource (41 pages) text txt rdacontent computer c rdamedia online resource cr rdacarrier "2004 Frijda Lecture, Cognitive Science Center, Amsterdam." Includes bibliographical references (pages 34-41). The hippocampal formation and memory -- Elements of a neurobiological theory of the hippocampus and the role of NMDA receptor-dependent synaptic plasticity -- Experimental observations -- Conclusion -- References. Print version record. Hippocampus (Brain) http://id.loc.gov/authorities/subjects/sh85060982 Memory. http://id.loc.gov/authorities/subjects/sh85083497 Hippocampus https://id.nlm.nih.gov/mesh/D006624 Hippocampe (Cerveau) SOCIAL SCIENCE Anthropology Physical. bisacsh Hippocampus (Brain) fast Memory fast has work: Elements of a neurobiological theory of the hippocampus (Text) https://id.oclc.org/worldcat/entity/E39PCGyJPKCMXk49tChPhHv7Md https://id.oclc.org/worldcat/ontology/hasWork Print version: Morris, R.G.M. (Richard G.M.). Elements of a neurobiological theory of the hippocampus. Amsterdam : Vossiuspers UvA, ©2005 9789056293796 FWS01 ZDB-4-EBA FWS_PDA_EBA https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=158067 Volltext |
| spellingShingle | Morris, R. G. M. (Richard G. M.) Elements of a neurobiological theory of the hippocampus : the role of activity-dependent synaptic plasticity in memory / The hippocampal formation and memory -- Elements of a neurobiological theory of the hippocampus and the role of NMDA receptor-dependent synaptic plasticity -- Experimental observations -- Conclusion -- References. Hippocampus (Brain) http://id.loc.gov/authorities/subjects/sh85060982 Memory. http://id.loc.gov/authorities/subjects/sh85083497 Hippocampus https://id.nlm.nih.gov/mesh/D006624 Hippocampe (Cerveau) SOCIAL SCIENCE Anthropology Physical. bisacsh Hippocampus (Brain) fast Memory fast |
| subject_GND | http://id.loc.gov/authorities/subjects/sh85060982 http://id.loc.gov/authorities/subjects/sh85083497 https://id.nlm.nih.gov/mesh/D006624 |
| title | Elements of a neurobiological theory of the hippocampus : the role of activity-dependent synaptic plasticity in memory / |
| title_auth | Elements of a neurobiological theory of the hippocampus : the role of activity-dependent synaptic plasticity in memory / |
| title_exact_search | Elements of a neurobiological theory of the hippocampus : the role of activity-dependent synaptic plasticity in memory / |
| title_full | Elements of a neurobiological theory of the hippocampus : the role of activity-dependent synaptic plasticity in memory / R.G.M. Morris. |
| title_fullStr | Elements of a neurobiological theory of the hippocampus : the role of activity-dependent synaptic plasticity in memory / R.G.M. Morris. |
| title_full_unstemmed | Elements of a neurobiological theory of the hippocampus : the role of activity-dependent synaptic plasticity in memory / R.G.M. Morris. |
| title_short | Elements of a neurobiological theory of the hippocampus : |
| title_sort | elements of a neurobiological theory of the hippocampus the role of activity dependent synaptic plasticity in memory |
| title_sub | the role of activity-dependent synaptic plasticity in memory / |
| topic | Hippocampus (Brain) http://id.loc.gov/authorities/subjects/sh85060982 Memory. http://id.loc.gov/authorities/subjects/sh85083497 Hippocampus https://id.nlm.nih.gov/mesh/D006624 Hippocampe (Cerveau) SOCIAL SCIENCE Anthropology Physical. bisacsh Hippocampus (Brain) fast Memory fast |
| topic_facet | Hippocampus (Brain) Memory. Hippocampus Hippocampe (Cerveau) SOCIAL SCIENCE Anthropology Physical. Memory |
| url | https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=158067 |
| work_keys_str_mv | AT morrisrgm elementsofaneurobiologicaltheoryofthehippocampustheroleofactivitydependentsynapticplasticityinmemory |