Kompetencat e mësimdhënësve për identifikimin dhe zhvillimin e talentit në muzikë:
Saved in:
| Main Author: | |
|---|---|
| Format: | Book |
| Language: | Albanian |
| Published: |
Prishtinë
Botime Artini
2024
|
| Subjects: | |
| Online Access: | Inhaltsverzeichnis Literaturverzeichnis |
| Physical Description: | 238 Seiten Diagramme 25 cm |
| ISBN: | 9789951283045 |
Staff View
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV049787914 | ||
| 003 | DE-604 | ||
| 005 | 20240814 | ||
| 007 | t | ||
| 008 | 240719s2024 |||| |||| 00||| alb d | ||
| 020 | |a 9789951283045 |9 978-9951-28-304-5 | ||
| 035 | |a (OCoLC)1450723935 | ||
| 035 | |a (DE-599)BVBBV049787914 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a alb | |
| 049 | |a DE-12 | ||
| 084 | |a OST |q DE-12 |2 fid | ||
| 100 | 1 | |a Qarri, Elizabeta |d ca. 20./21. Jh. |e Verfasser |0 (DE-588)1338900234 |4 aut | |
| 245 | 1 | 0 | |a Kompetencat e mësimdhënësve për identifikimin dhe zhvillimin e talentit në muzikë |c Dr.Sc. Elizabeta Qarri |
| 264 | 1 | |a Prishtinë |b Botime Artini |c 2024 | |
| 300 | |a 238 Seiten |b Diagramme |c 25 cm | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 650 | 0 | 7 | |a Musikerziehung |0 (DE-588)4040843-7 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Begabtenauslese |0 (DE-588)4302632-1 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Albaner |0 (DE-588)4068517-2 |2 gnd |9 rswk-swf |
| 651 | 7 | |a Kosovo |0 (DE-588)4032571-4 |2 gnd |9 rswk-swf | |
| 689 | 0 | 0 | |a Kosovo |0 (DE-588)4032571-4 |D g |
| 689 | 0 | 1 | |a Albaner |0 (DE-588)4068517-2 |D s |
| 689 | 0 | 2 | |a Musikerziehung |0 (DE-588)4040843-7 |D s |
| 689 | 0 | 3 | |a Begabtenauslese |0 (DE-588)4302632-1 |D s |
| 689 | 0 | |5 DE-604 | |
| 856 | 4 | 2 | |m Digitalisierung BSB München 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=035128746&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 856 | 4 | 2 | |m Digitalisierung BSB München 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=035128746&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |3 Literaturverzeichnis |
| 940 | 1 | |n oe | |
| 940 | 1 | |q BSB_NED_20240719 | |
| 942 | 1 | 1 | |c 780.9 |e 22/bsb |f 090513 |g 4975 |
| 942 | 1 | 1 | |c 370.9 |e 22/bsb |f 090513 |g 4975 |
| 943 | 1 | |a oai:aleph.bib-bvb.de:BVB01-035128746 | |
Record in the Search Index
| _version_ | 1815416591776481280 |
|---|---|
| adam_text |
PËRMBAJTJA: PARATHËNIE. 11 HYRJE. 13 I. KOMPETENCAT PROFESIONALE TË MËSIMDHËNËSVE - BAZATTEORIKE. 17 1.1 Kompetencat dhe procesi mësimor. 17 1.1.1 Kompetencat e mësimdhënies sipas strukturës arsimore. 19 1.1.2 Kompetencat sipas Inovacioneve Pedagogjike. 20 1.1.3 Kompetencat e mësimdhënësve. 21 1.2 Zhvillimi i kompetencave profesionale të mësimdhënësve . në arsimin fillor. 26 1.3 Zhvillimi i kompetencave profesionale të mësimdhënëve në . zhvillimin profesional dhe të nxënët e përhershëm gjatë gjithëjetës. 29 II. KURRIKULA E EDUKIMIT DHE E KOMPETENCAVE MUZIKORE. 35 2.1 Rishikimi historik i kornizës kurrikulare të programeve të edukimit muzikor në Kosovë dhe rrënjët e tyre në programet jashtë BE-së. 35 2.2 Rishikimi konceptual i edukimit muzikor në shkolla dhe. kurrikula kombëtare në Kosovë. 40 2.3 Trajnimi i mësimdhënësve për zbatimin e Kurrikulës. 44 2.3.1 Trajnimi i mësimdhënësve,
mundësitë dhe besimi.47 2.4 Zhvillimi i veshit muzikor. 51 2.4.1 Zhvillimi i ndjenjës ritmike. 52 2.4.2 Ndjenja ritmike në fazën e përjetimit. 54 2.4.3 Ndjenja ritmike në fazën e njohjes. 56 2.4.4 Zhvillimi i ndjenjës melodike.57 2.4.5 Ndjenja melodike në fazën e përjetimit. 58 2.4.6 Ndjenja melodike në fazën e njohjes. 59 7
Elizabeta Qarri 2.4.7 Zhvillimi i ndjenjës harmonike. 60 2.5 Zhvillimi i shijes muzikore. 62 2.5.1 Kënga sipjesë e zhvillimit të shijes artistike. 63 2.5.2 Dëgjimi i muzikës ndikon nëpersonalitetin efêmijës. 64 2.5.3 Qasje në vepra muzikore të dëgjueshme. 66 2.6 Metodat e vlerësimit. 67 1.6.1 Objektivi i vlerësimit. 69 1.6.2 Rëndësia e vlerësimit të nxënësve. 69 III. KOMPETENCA E MËSIMDHËSVE TË EDUKIMIT MUZIKOR. 71 3.1 Kompetenca muzikore-pedagogjike.71 3.2 Fushat kryesore për zhvillimin e kompetencave. 84 3.3 Marrëdhënia e inteligjencës muzikore dhe e kompetencave.87 3.4 Koncepti dhe nocioni i kompetencës në edukimin muzikor. 90 3.5 Matja e kompetencave të mësimdhënësve të muzikës. 95 3.6 Kompetenca e mësimdhënësve të muzikës dhe arritjet e nxënësve. 101 IV. DHUNTIA, KREATIVITET,TALENTI . 109 4.1 Koncepti i kreativitetit, dhuntisë dhe talentit. 109 4.1.1 Talenti
muzikor. 111 4.1.2 Karakteristikat e fëmijëve të talentuar. 112 V. IDENTIFIKIMI, ZBULIMI DHE INKURAJIMII NXËNËSVE TË TALENTUAR NË MUZIKË. 123 5.1 Mekanizmat dhe instrumentet për identifikimin e nxënësve të talentuar në muzikë. 123 5.2 Roli i mësimdhënësit të edukimit Muzikor në zbulimin dhe . inkurajimin e nxënësve të talentuar në muzikë.126 8
KOMPETENCAT E MËSIMDHËNËSVE PËR IDENTIFIKIMIN DHE ZHVILLIMIN E TALENTIT NË MUZIKË VI. METODOLOGJIA E . . 139 6.1 Lënda e hulumtimit. 139 6.2 Problemi i hulumtimit. 139 6.3 Qëllimi i hulumtimit. .140 6.4 Paradigma kërkimore. 140 6.5 Lloji i hulumtimit. 140 6.6 Hipoteza e përgjithshme. 141 6.7 Popullata dhe mostra. 142 6.8 Procedural dhe instrumentet kërkimore. .143 VIL PJESA EMPIRIKE E KËRKIMIT. 145 7.1 Karakteristikat demografike të të anketuarve. 145 7.2 Shpërndarja e variablave në kampion. 149 7.3 Prezantimi i rezultateve të të anketuarve - mësimdhënësve. 153 7.4 Prezantimi i rezultateve të debrifikimeve - studentë. 165 7.5 Rezultatet sipas dallimeve të variablave sipas institucionit arsimor (fillor dhe i mesëm). 166 7.6 Analiza faktoriale e ndikimit të faktorëve sociodemografikë në qëndrimin e të anketuarve. 182 VIII. VËZHGIMET
PËRFUNDIMTARE. 189 8.1 Vëzhgime përmbyllëse për mësimdhënësit dhe nxënësit e anketuar. 189 8.2 . Interpretimi i hipotezave. 195 KONKLUZIONE DHE REKOMANDIME. 199 LITERATURA. 203 SHTOJCA.223 RECENSIONETE LIBRIT. 231 RECENSION Prof.Valton Beqiri, kompozitor.237 9
LITERATURA Asme Ace, T. (1973) Report of Joint Sub-Committee of ASME/ACE in NSW on ways of increasing the quality and consistency of music education in infant and primary schools. Sydney, Australia Achilles, E. (1999). Creating musical environments in early childhood programs. Young Children, 54(1) Adib Y, Fathi Azar A, Arefhejad S (2017). Teacher-student professional Identity in Farhangian University in East Azarbaijan Province, Farhangian University: Quarterly Journal of Tarbiat Moalem 1(1): 147167. Adderley, K., Ashwin, C., Bradbury, P., Freeman, J., Goodland, S., Greene, J., Jenkins, D., Rae, J. Uren, О (1975). Project Methods in Higher Education. London: Society for Research into Higher Education. Abbott, I. Rathbone, Μ. Whitehead, Ph. (2019) The Transformation Of Initial Teacher Education - The Changing Nature of Teacher Training. Routledge 2 Park Square, Milton Park, Abingdon, Oxon 0X14 4RN Aranovski, Μ. (1990). Kam intonatsionnata teoria na motiva. Muzikalni horizonti. Asafiev, B. (1971). Muzbikalynaya forma как protsess, Leningrad: Izdatelstvo “Muzbika”. 1971. Adler, A. (2005). Psikologjia individuale në shkollë dhe psikologjia e edukimit. Tiranë: Kristalina-KH. Agostini, P. (2007). La consulenza educativa. Rilevanze personal! tecniche e strumenti pedagogici nel contesto penale minorile. Catanzaro: La rondine. Ahmed, A. (1987). Better mathematics: A curriculum development study based on the low attainers in mathematics project. London: HM Stationery Office. Alexander, R. (1994). The classteacher and the curriculum’ in Pollard, Andrew and Bourne, Jill (eds., 1994)
. Teaching and Learning in the Primary School Routledge. Apple, Μ. W. (1993). The Politics of Official Knowledge:Does a National Curriculum Make Sense? Teachers College Record, 95(2),. Aubrey, C. (1994). The Role of Subject Knowledge in the Early Years of Schooling. The Falmer Press 203
Elizabeta Qarri Abramo, J. (2012) Disability in the classroom: Current trends and impacts on music education. Music Educators Journal, 99(1), 39-45. DOI: 10.1177/0027432112448824 Alekseev, A.D. (1988) Istoriya fortepiannogo iskusstva (The History of Art of Piano), in 3 parts, Muzyka (Music). Andriushchenko, T. K. (2015). Teoretyko-metodychni zasady formuvannia zdorov’iazberezhuvalnoi kompetentnosti v ditei doshkilnoho viku [Theoretical and methodological framework for forming preschoolers’ health-preserving competency] South Ukrainian National Pedagogical University, Odesa. Abykanova, B.,Tashkeyevab, G., Idrissova, S.,Bilyalova, Z. Sadirbekovac, D. (2016). Professional Competence of a Teacher in Higher Educational Institution. Intertational Journal of Environmental Science Education, 11(8), 2197-2206. Blömeke, S. et al. (2016) The relation between content-specific and general teacher knowledge and skills. Teaching and Teacher Education Beland, Louis-Philippe and Richard Murphy, (2015) “Ill Communication: Technology, Distraction Student Performance,” The London School of Economics and Political Science, Centre for Economic Performance, CEP Discussion Paper No 1350. Benedict, Cathy (Editor); Patrick Schmidt (Editor); Gary Spruce (Editor); Paul Woodford (Editor), (2018) The Oxford Handbook of Social Justice in Music Education. Oxford University Press. Basbay, Μ. and Ates, A. (2009). The reflections of student teachers on project based learning and investigating self evaluation versus teacher evaluation. Procedia - Social and Behavioral Sciences, 1, 242-247. Bitinas, B.(2006).
Edukologinis tyrimas: sistema ir procesas (Educational Research: System and Process). Vilnius: Kronta, (Chapter 8) (pp. 170177) (In Lithuanian). Ballantyne, J. (2006). Reconceptualizing Pre-service Teacher Education Courses for Music Teachers: The Importance of Pedagogical Content Knowledge and skills and Professional Knowledge and Skills. Research Studies in Music Education, 26(1), 37-50. Beijaard, D. Verloop, N. (1996) Assessing teachers’ practical knowledge. Studies in Educational Evaluation, 22(3), 275-286. Retrieved 13th May, 2015 from https://www.sciencedirect.com pii Burton, Judith; Horowitz, Robert and Abeles, Hal, (2001) Learning In and Through the Arts. Columbia University Press. 204
KOMPETENCAT E MËSIMDHËNËSVE PËR IDENTIFIKIMIN DHE ZHVILLIMIN E TALENTIT NË MUZIKË Ballata, Z. (1987). Gjurmëve të muzës. Prishtine Bandura, A. (1997). Self-Efficacy: The Exercise of Control, Freeman. New York: New York. Barrett, Μ. S. (2009). Sounding lives in and through music: A narrative inquiry of the ‘everyday’ musical engagement of a young child. Journal of Early Childhood Research, 7,. Bates, R. (2008). Teacher education in a global context: towards a defensible theory of teacher education. Journal of education for teaching, 34(4),. Bashiruddin, A. (2018) Teacher Development and Teacher Education in Developing Countries - On Becoming and Being a Teacher. Palgrave company Macmillan Publishers Ltd. 4 Crinan Street, London, N1 9XW, United Kingdom Beauchamp, G. (1997). Initial Training + Inset = Confident Teachers. A Formula for success?’,. B. J. Music Ed. (1997), 14,. Beethoven, T. (2016). Donors Choose, org. Retrieved from https:// www.donorschoose.org/project/music-can-change-the-worldludwigvan/665260/ Bell, J. (1993). Doing Your Research Project OUP, Buckingham. Philadelphia,. Binns, T. (1994). Children Making Music. Simon Schuster Education. Black, P. (2001). Formative assessment and curriculum consequences. (C. a.-2. In D. Scott (Ed.), Ed.) London: : Ablex Publishing. Bresler, L. (1993). Music in a double-bind: Instruction by non-specialists in elementary schools. Bulletin of the Council for Research in Music Education, 1-13. Bruner, J. (2003). Kultura e edukimit. Tiranë: ISP. Bryman, A., Bell, E. (2007). Business research method. Oxford: Oxford: Oxford Press
University. Bryman, A., Burgess, R. (1994). an introduction analyzing qualitative data, 1-17.Developments in qualitative data analysis:. BYO, S. J. (1999). Classroom Teachers’ and Music Specialists’ Perceived Ability to Implement the National Standards for Music Education. Journal of Research in Music Education, 47(2), 111-123. doi: 10.2307/3345717. Barry, Nancy. H. (1992), »Music and education in the elementary music methods Biasutti, Michele (2010), »Investigating trainee music teachers’ beliefs on musical 205
Elizabeta Qarri Bresler, L. (1991). Custom and cherishing, IL: National Arts Education Research Centre, dass«, Journal of Music Teacher Education, 2(1), str. 16-23. Comte, Μ. (1988). The arts in Australian School: The past fifty years. International Journal for Music Education, 1(1): 102-21. Clark, B. , Growing up Gifted. U.S.A.: Charles E. Merrill Publishing Co., (1983). Campbell, P. S., (2008) Musician and teacher. New York: W.W. Norton and Company. Chosky, L., Abramson, R., Gillespie, A., Woods, D., York, F. (2000). Teaching music in the twenty-first century (2nd ed.). Upper Saddle River, NJ: Pearson. Colwell, C., (2002) Learning disabilities in the music classroom: Implications for the music educator. Update: Applications of Research in Music Education, 21(2), 9-16. Costantoura, P. (2001 ). Australians and the arts, Sydney,, Australia: Federation Press. Covell, R. 1970. Music in Australia: Needs and prospects, Sydney, , Australia: Unisearch.doi: https://doi.org/10.1177/105708379200200104 Chionna, A. (2007). Pedagogia della dignita umana. Brescia: La Scuola. Colley, B. (1991). Finding common ground: Art Schools and Ed Schools, Designing for Arts in Education, 93(2),. Cooper, D. R., Schindler, P. S. (2003). Business Research Methods (Vol. 12th Edition). (1. Edition, Ed.) Toronto, Canada: McGraw-Hill/Irwin. Cox, G., Stevens, R. (2010). The origins and foundations of music education: crosscultural historical studies of music in compulsory schooling: London. New York. Continuum. Creswell, J. W. (2003). Research design : qualitative, quantitative, and mixed methods
approaches. ((. ed.), Ed.) London: London: Sage. . Crowl, T. K. (1996). Fundamentals of educational research. Brown Benchmark Madison. Çaushi, T. (1998). Fjalor i estetikës. Tiranë: Onrufi. Conway, C. (2015). The Experiences of First-Year Music Teachers: A Literature Review. Applications of Research in Music Education, 33(2), 65-72. Dyganova, E. Yavgildina, Z. (2015). Organization a Culture of SelfEducation of Music Teachers. International Education Studies, 8(6), 95ЮЗ. 206
KOMPETENCAT E MËSIMDHËNËSVE PËR IDENTIFIKIMIN DHE ZHVILLIMIN E TALENTIT NË MUZIKË Duke, D. L. Stiggins, R.J.(1990). Beyond minimum competence: evaluation for professional development. In Millmann J.; DarlingHammond L. (eds.). The new handbook of teacher evaluation. Assessing elementary and secondary teachers, p. 116-132. Newbury Park, CA: Sage. Retrieved 13th May, 2015 from https://eric.ed.gov . Dunkin, Μ., Biddle, B. (1974). The study of teaching. New York, NY: Holt, Rinehart Winston. Retrieved from www.sagepub.in/upm-data Davis, D. D. (1989). Technology Acceptance Model. Managment Science. Dibaee Saber Μ, Abbasi E, Fathi Vajargah K, Safaee Movahed S. (2016). Explaining the dimensions of teachers’ professional competencies and Analyzing Its Place in the Upper Documents of Education in Iran, Biannual Journal of Training Learning Researches 13(2):109-124. DES. (1998). Teaching High Status. High Standards: Requirements for Courses of Initial Teacher Training. London: DES. Domenico, S. (2011). Dimensione pedagogica della relazione d’aiuto. Milano: La consulenza educativa Durrant, C., Welch, G. (1995). Making Sense of Music: Foundation for Music Education. London: Cassell. Eisner, E. W. (1993). Reshaping assessment in education Some criteria in search of practice. Journal of Curriculum Studies, 25(3). Emërllahu, D. (2001). “Edukatë estetike”,. “Edukatë estetike”,. English, F. W. (n.d.). Educational consulting. New Jersey: Educational Technology Publications. English, F. W., Steffy, B. E. (1994). Total quality education. Canada: SAGE Publications. European Commission
(2006). Recommendation of the European Parliament and of the Council of 18 December 2006 on key competences for lifelong learning, 32006H0962 C.F.R. European Commission (2013). Supporting Teacher Competence Development for Better Learning Outcomes. Brussels. European Union (2017). Conclusions ofthe Council and ofthe Representatives of the Governments of the Member States: Meeting within the Council of 15 November 2017, on improving the quality of teacher education EuropeanUnion (2018). Conclusions ofthe Council and ofthe Representatives of the Governments of the Member states: Meeting within the Council of 21 November 2018 on preparing young people for the 21st century: an agenda for European cooperation 207
Elizabeta Qarri European Union (2019). Council Conclusions of 26 November 2019 on the Professional Development of Teachers and School Leaders (ODcial Journal 2019/C 302 Fenzio, F. (2013). Che cosa significa educare? Una bussola per insegnanti, educatori, consulenti pedagogic! e genitori. Bergamo: Junior. Fisher, C. (2007). Researching and Writing a Dissertation: A Guidebook for Business Students Financial Times. Prentice Hall. Flash, L. (1993). Music in the Classroom at Key Stage 1’ in Glover, Joanna and Ward, Stephen (eds., 1993) . Teaching Music in the Primary School Cassell. Forari, A. (2007). Making sense of music education policy. British Journal of Music Education, Frabboni, F. Μ. (2010). Introduzione alia pedagogia generale . Bari: Laterza. Frost Kissinger. Frost, J. L., Kissinger, J. B. (1976). The young child and the educative process. New York: Holt, Rinehart and Winston. Fullan. (1993). Why Teachers Must Become Change Agents. The Professional Teacher, 50(6). Fullan, Μ. (2001). “Kuptimi i Ri i Ndryshimit në Arsim”,. Fullan, Μ. (2010). Força e ndryshimit. Tiranë: Toena. Fullan, Μ. (2010). Força e ndryshimit. Tiranë. Fiske , E. , ed . 1999 . Champions of change: The impact of the arts on learning . Washington, DC : The Arts Education Partnership . Feldman, D.: Naturus gambit. Child progies and the development of human potential, New York, Basic Books, Inc, 1987 11. Fitzpatrick, K. (2012). Cultural Diversity and the Formation of Identity: Our Role as Music Teachers. Music Educators Journal, 98(4), 53-59. Grant, J Drafall, L. (1991). Teacher effectiveness research. A
review and comparison. Bulletin of the Council for Research in music education. 108(1), 31-48 Gaysina, L. (2004). Gotovnosty studentov vuza к obshteniyu v mulytikulyturnoy srede i ее formirovanie, Monografia. Orenburg: Rik Gou Ogu. Gaytandzhiev, G.; Popova, Μ.; Mladenova, P. (2005). Muzika za chetvarti klas, Sofija: Bulvest Gojkov, G. Stojanovic, A. (2014) - Kompetencije ucitelja za identifikaciju I, 208
KOMPETENCAT E MËSIMDHËNËSVE PËR IDENTIFIKIMIN DHE ZHVILLIMIN E TALENTIT NË MUZIKË Gallagher, J. J. (1985) Teaching the gifted children, Boston, Allyn Bacon, 12. Gardner, H. (1985). Frames of Mind: The Theory Of Multiple Intelligences. London: London Garin, E. (2020) Clinically Based Teacher Education in Action - Cases From Professional Development Schools. Information Age Publishing, Inc. Charlotte, NC Gregson, Μ. Spedding, P. (2020) Practice-Focused Research in Further Adult and Vocational Education - Shifting Horizons of Educational Practice, Theory and Research. Palgrave Macmillan, Springer Nature AG 11, 6330 Cham, Switzerland Ghanizadeh Graeeli Μ, Jafari P, Gholighorchian N (2017). The effect of professional competencies on the development of high school teachers in Tehran, management on training organizations 6(l):51-72. Gifford, E. (1993). The Musical Training of Primary School Teachers: Old Problems, New Insights and Possible Solutions’, . B. J. Music Ed: (1993), 10,. Gilbert, J. (1981). Musical Starting Points with Young Children. Ward Lock Educational. Gërliq, D. (1984). Estetika. Prishtinë, Prishtinë: Rilindja. Gordon, E. E., (2007) Learning sequences in music: A contemporary music learning theory. Chicago, IL: GIA. Glover, J., Ward, S. (1993). Changing Music’ in Teaching Music in the Primary School, Cassell. (1. eds., Ed.) Green, L. (. (2005b). Musical meaning and social reproduction. A case for retrieving autonomy. Educational Philosophy and Theory, 37(1). Green, L. (1997). Music, gender, education. Cambridge University Press. Green, L. (2008). Music, informal
learning and the school: Anew classroom pedagogy.Aldershot Burlington. Ashgate Publishing. Green, L. (2011). Learning, teaching, and musical identity: Voices across cultures. .Bloomington. : Indiana University Press. Guskey, T. R. (2002). Professional development and teacher change. Teachers and Teaching: theory and practice, 8(3). Hobcroft, R. (1980). Report of Ministerial Taskforce of Enquiry into Music Education in Primary Schools, Sydney, , Australia: NSW Ministry of Education. IRMA. (2005) .From http://www.thecorrswebsite.com/news/mar05/mar09b. htm (Retrieved on March 2, 2006). 209
Elizabeta Qarri Hala, Μ. (2012). Metodika e edukimit muzikor - kurrikula dhe elementet e saj. Tiranë. Hargreaves. (1996). The Development of Artistic and Musical Competence. (J. (.-1. In I . Deliege Sloboda, Trans.) Oxford: Oxford University Press. Heller, K. A.; Feldhusen, J. F. (1986) Identifying and nurturing the gifted. An international perspective, Studgard, Huber Hargreaves, D. J., North, A. C. (1999). The Function of Music in Everyday Life Redefining the Social in Music Psychology. Psychologv of Music. 27, p. 71-83. Hargreaves, D. L. (2002). Young people’s music in and out of school: A study of pupils and teachers in primary and secondary schools. A UK Qualifications and Curriculum Authority’s (QCA) (2003) Curriculum Development Project in the Arts and Music Monitoring Programme. British Journal of Music Education 20, 229-241. Csikszentmihalyi, Μ. (2013). Creativity: The psychology of discovery and invention. New York: HarperCollins. Hargreaves, D. L., Tarrant, Μ. (2002). Young people’s music in and out of school: A study of pupils and teachers in primary and secondary schools. (A. U. Programme, Ed.) British Journal of Music Education (2003) 20, 229-241. Hamann, D. L. Cooper, Sh. C. (2016) Becoming a Music Teacher - From Student to Practitioner. Published in the United States of America by Oxford University Press 198 Madison Avenue, New York, NY 10016 HDR. (2006). Youth A new generation for a new Kosovo: HDR (HUMAN DEVELOPMENT REPORT). Pristina: Prishtina: UNDP. Hennessy, S. (2006). Don’t forget the teachers. Times Educational Supplement, The Teacher, March 24th.
HMI. (1991). Aspects of Primary Education: The Teaching and Learning of Music.London: HMSO. Holden, H., Button, S. (2006). The teaching of music in the primary school by the nonmusic specialist. British Journal of Music Education, 23(1), 23-38. . Huberman, Μ. (1995). Networks That Alter Teaching: conceptualizations, exchanges and experiments (doi: 10.1080/1354060950010204 ed.). Teachers and Teaching, 1(2), 193 Hysi, F. (2005). Estetikë në tri pamje. Estetikë në tri pamje. 210
KOMPETENCAT E MËSIMDHËNËSVE PËR IDENTIFIKIMIN DHE ZHVILLIMIN E TALENTIT NË MUZIKË Iliev, D., Atanasova-Pacemska, T. (2012). Teacher competences between yesterday and tomorrow-Macedonian case study. Procedia-Social and Behavioral Sciences, (46), 2294 Yakovlev, V. (2010). The theoretical model of music performance competence of the future music teachers. Research notes. Online Journal of the Kursk State University, 2(14), 89 Johnson,V.V. (2010) “Competencies, Curricula and Compliance”: An Analysis of Music Theory in Music Education Programs in Texas. Doctoral Dissertation Submitted to the College of Fine Arts. Retrieved Feb.12th,2012 from Proquest Dissertations and Theses Database. Johansen, G. (2009). Relations between educational quality in music teacher education and students’ perceptions of identity. Nordic Research in Music Education Yearbook, 10. Jorgensen, E. R. (2008). The art of teaching music. Indiana University Press. Jeanneret, N. (1997). Model for developing preservice primary teachers’ confidence to teach music. Bulletin of the Council for Research in Music Education, 133: 37-44. Junius, E. (2005). A brief overview of music and arts education for Namibian children, in music in schools for all children: From research to effective practice, Granada: MISTEC. Janos, P. Μ., Fung, H. C., Robinson, N. Μ. (1985). Self-concept, self-esteem, and peer relations among gifted children who feel “different.” Gifted Child Quarterly, 29(2), 78 Jaques-Dalcroze, E., (1980) Rhythm, Music Education. London. Kodaly, Z., (1965) 333 elementary exercises. London: Boosey Hawkes. Kim, Y.
Y. (2001 ). Training non-specialists in early childhood music education of Korea . In Proceedings from the 3rd Asia-Pacific Symposium on music education research and International Symposium on ‘Uragoe’ and Gender, Minami Y. and Μ. Shinzanoh. Japan : Asia-Pacific Symposium for Music Education Research (APSMER). Kornhaber, Μ., Μ. Krechevsky (2002) Expanding definitions of learning and teaching: notes from MI underground, http://learnweb.edu/wide/ courses/files/expanding.htm (Retrieved September 20, 2002). Khoroshi P, Nasr AR, Mirshah Jafari SE, Mosapoor N (2017). Investigating the approach of training a worthy teacher based on Educational Documents of the Islamic Republic of Iran, quarterly Journal of Rahbord Farhang 10(7): 163-1186. 211
Elizabeta Qarri Kaschub, Μ. Smith, J. (2014) Promising Practices in 21st Century Music Teacher Education. Published in the United States ofAmerica by Oxford University Press 198 Madison Avenue, New York, NY 10016 Kiehn, Μ. T. (2003). Development of music creativity among elementary school students. Journal of Research in Music Education, 51(4), 278288. Karmazina, Zh.B. (2009). Hudozhestvennoe samoobrazovanie uchitelja muzyki как uslovie razvitija ego professional’noj kompetentnosti: Avtoref. dis. kand. ped. Nauk. Moskva. Kuzymina, N.V. (1985). Sposobnosti, odarennosty, talant uchitelya. Leningrad: Znanie, Kalemi, S., Zadeja, T. (1989). ’’Metodika e mësimit të këngës dhe muzikës”. Tiranë. Kanti, I. (1977). Mbi të bukurën e të madhërishmën. Kemp, A. E. (1996). The Musical Temperament. Oxford: Oxford University Press. Koliqi, H. (1997). “Historia e Pedagogjisë Botërore”,. Prishtinë. Lawrence, I. (1975). Music and the Teacher. Pitman Publishing. Lance, D. (2014). Teacher Evaluation: Archiving Teaching Effectiveness Nielsen. Music Educators Journal, 101(1), 63-69. Laor, L. (2015). Evaluating Graduate Education and Transcending Biases in Music Teachers’ Professional Development. Journal of Education and Training Studies, 3(1), 56-63. Legette, R. McCord, D. (2015). Pre-Service Music Teachers Perceptions of Teaching and Teacher Training Legette. Contributions to Music Education, 40(1) 163-176. Legette, R. (2013). Perceptions of Early-Career School Music Teachers Regarding Their Preservice Preparation. Applications of Research in Music Education, 32(1), 12-17. Lok, D. (1950).
Misli о vaspitanju. Beograd. Lean , B. (1997) Strategies to overcome the low status of music in the curriculum . In New sounds for a new century, E. Gifford , A. Brown , and Thomas A. . Brisbane, Australia : Australian Society for Music Education (ASME). Lepherd, L. (1995). Music education in international perspective - National systems, QD,, Australia: University of Southern Queensland. Lepherd, L. n.d. (2019) Music education in international perspective Australia . QD,, Australia: University of Southern Queensland . 212
KOMPETENCAT E MËSIMDHËNËSVE PËR IDENTIFIKIMIN DHE ZHVILLIMIN E TALENTIT NË MUZIKË Mans, Μ. ( 1994). “ANamibianperspective ”. InMusic education: International viewpoints, Edited by: Comte, Μ. Perth,, Australia: Australian Society for Music Education/Calleway International Resource Centre for Music Education (ASME/CIRCME). Mans, Μ. ( 1997). “The National curriculum in Namibia”. In Music in schools and teacher education: A global perspective, Edited by: Leong, S. Perth, , Australia: International Society for Music Education/Callaway International Resource Centre for Music Education (ISME/ CIRCME). Mans, Μ. (2002). “Playing the music - comparing performance of children’s song and dance in traditional and contemporary Namibian education”. In The arts in children’s lives, Edited by: Bresler, L. and Thompson, C. 7186. The Netherlands: Kluwer Academic. McKellar, D. (1990). “Music as an experience: The experience of heritage music”. In Music education: Facing the future, Edited by: Dobbs, J. 815. Christchurch,, New Zealand: ISME. McPherson, G. (1997). “Music in a changing environment: An Australian perspective”. In Music in schools and teacher education: A global perspective, Edited by: Leong, S. 170-178. Perth, , Australia: ISME/ CIRCME. Merrion, Μ Larsen, C. (1986). How do you evaluate a music teacher? Principal, 66 (1), 30 Martin, C. Polly, D. (2017) Handbook of Research on Teacher Education and Professional Development. IGI Global Information Science Reference (an imprint of IGI Global) 701 E. Chocolate Avenue Hershey PA, US A 17033 Marcheva, P. (2012). Intercultural Education
and Children’s Musical Experience, I. International Balkan Congress Proceedings, Istanbul, ISBN: 978- 605-63388-0-9, p. 795-801. Mincheva, P.; Pehlivanova P. (2005). Muzika za chetvarti klas, Sofija: Prosveta. MacDonald, R. A., Miell, D. (2000). Creativity and Music Education: The Impact of Social Variables, (d. 10.1177/025576140003600107, Ed.) International Journal of Music Education, os-36(l), 58-68. Marsh, C. J. (2009). Koncepte themelore për ta kuptuar kurrikulumin. Tiranë: cde. MASHT. (2011). Korniza Kurrikulare eArsimit Parauniversitar tëRepublikës së Kosovës. Prishtinë. MASHT. (2011). Standardet e vlerësimit - Udhëzuesi. Prishtinë. 213
Elizabeta Qarri MASHT. (2012). Kurrikula e re. Prishtinë: Masht. Mato, E. (2003). Edukimi ndërkulturor dhe i të drejtave të njeriut në shkollë: manual trajnimi për mësimdhënësit e shkollës 8- vjeçare. Tiranë: Dita. McCulloch, G. (2011). The struggle for the history of education:. Taylor Francis. MEST. (2001). The New Kosovo Curriculum Framework, (http:// www.mashtgov.net/advCms/documents/New%20Kosova%20 Curriculum%20Framework.pdf., Ed.) Prishtinë: Prishtina: MEST Retrieved from. Melash, Valentyna D. and Molodychenko, Valentin V. and Huz, Volodymyr V. and Varenychenko, Anastasiia B. Kirsanova, Svitlana S. (2020) Modernization of Education Programs and Formation of Digital Competences of Future Primary School Teachers. International Journal of Higher Education, 9 (7). pp. 377-386. ISSN 1927-6044 Milutinovic, J. (2008). Ciljevi obrazovanja i ucenja u svetlu dominantnih teorija vaspitanja 20. veka, Novi Sad: Savez pedagoskih drustava Vojvodine. Miliband, D. (2004). Excellence and Enrichment: New Frontiers in Music Education. Music for Life Conference. London, 3 March. Mills, J. (1989). The Generalist Primary Teacher of Music: a Problem of Confidence.Music Ed. (1989, 6, 2). Mills, J. (1991). Music in the primary school. Cambridge:: Cambridge University Press. Mills, J. (1997). Knowing the Subject Versus Knowing the Child: Striking the Right Balance for Children Aged 7-11 Years. Research Studies in Music Education. 9,. Morrison, K. (1993). Planning Accomplishing School-Centred Evaluation, . Peter Francis. Murray, H. (2008). Curriculum wars: national identity in education, (d.
10.1080/14748460801889886, Ed.) London Review of Education, 6(1). Musai, В. (1999). Psikologji edukimi. Tiranë: Pegi. Musai, В. (2003). Metodologji e mësimdhënies. Tiranë: Pegi. NAEYC. (2009). Developmentally appropriate practice in early childhood programs serving children from birth through age 8 (NAEYC position statement). (2. f. Author. Retrieved January 16, Trans.) Washington, DC Maikapar, S. Μ., (1963), Kak rabotai’ na royale: beseda s det’mi (How to Work on a Grand Piano: Conversations with Children), Leningrad: Gosydarstvennoe myzykalnoe izdatelstvo (Leningrad: State Music Publishing). 214
KOMPETENCAT E MËSIMDHËNËSVE PËR IDENTIFIKIMIN DHE ZHVILLIMIN E TALENTIT NË MUZIKË Manturzewska, Μ., (1994), “Les facteurspsychologiquesdans le développement musical et revolution des musiciensprofessionnels.” Zenatti, Arlette (Ed.) Psychologie de la musique (pp.258-290) Paris: Presse Universitaires de France. Milich, B., (1977), Vospitanie uchenika-pianista v 1-2 klasah, (Teaching a Pianist Student in the First and Second Grade). Kiev: Music Ukraine. Neigauz, G. G., (1988), Ob Iskusstve Fortepiannoi Igry: Zapiski Pedagoga, (On the Art of Piano Performance: Notes by a Teacher). 5 th Ed. Moscow: Myzyka (Moscow: Music). Nelson, D. (1993). Coordinating Music in the Primary School (Joanna and Ward, Stephen (eds., 1993) ed.). Teaching Music in the Primary School Cassell. Netti, B. (2000). An ethnomusicologist contemplates universals in musical sound and musical culture. (N. L.-4. In Wallin, Trans.) Cambridge, Massachussets. MIT Press. Newman et al. (2003). A typology of research purposes and its relationship to mixed methods. Thousand Oaks, CA. Sage.: In A. Tashakkori C. Teddlie (Eds.), Handbook of mixed methods in social and behavioral research (pp. 167-188). Nunnally, J. C. (1978). Psychometric theory. (2. ed., Ed.) New York: McGraw-Hill. NYC. (1994). Task Force on Meeting Starting points: Meeting the needs of our youngest children (NYC Carnegie Corporation, Task Force on Meeting the Needs of Young Children ed.). New York: Carnegie Corporation. OFSTED. (1995). Music. London: HMSO, AReview of Inspection Findings 1993/94. Ofsted. (2004). Tuning in: wider opportunities in
specialist instrumental tuition for pupils in Key Stage 2. London: OFSTED. Othman, J. Senom, F. (2020) Professional Development through Mentoring - Novice ESL Teachers’ Identity Formation and Professional Practice by Routledge, 52 Vanderbilt Avenue, New York, NY 10017 Pajares, Μ. F. (1992). Teachers’ beliefs and educational research: Cleaning up a messy construct. Review of educational research, 62(3), 307-332. Partono Prasetio, A., Azis, E., Fadhilah, D. Fauziah, A. (2017). Lecturers’ Professional Competency and Students’ Academic Performance. International Journal of Human Resource Studies, 7(1), 86-93 215
Elizabeta Qarri Pantic, N., Wubbels, T. (2010). Teacher competencies as a basis for teacher education-Views of Serbian teachers and teacher educators. Teaching and teacher education, 26(3), 694 Platoni. (1980). Republika, (http://www.goodreads.com/quotes/399405i-would-teachchildren-music-physics-and-philosophy-but-most, Ed.) Rilindja. Plutok, O.V. (2020). Features of technological competence of professional training teacher of technological profile. 132-137 [File PDF], URL: https://zenodo.org/record/3731240/files/Plutok.pdf Passos, A.F.J (2009).Comparative analysis of teacher competence and its effect on pupil performance in upper primary schools in Mozambique and other sacmeq countries. A project submitted in fulfillment of the requirements for the degree of PhD Policy Studies in the Department of Education Management and Policy Studies, Faculty of Education, University of Pretoria, Pretoria. Plummeridge, C. (1991). Music Education in Theory and Practice. London: The Falmer Press.Program, B. E. (2011 ). Vlerësimi formativ. Prishtinë. Raths, J., McAninch, A. C. (2003). Teacher beliefs and classroom performance: The impact of teacher education (Vol. Vol. 6). Information Age Pub Incorporated. Regan A. R. G. Garth, N. (2022) Transforming introductory psychology : expert advice on teacher training, course design, and student success / edited by Regan A.R. Gurung and Garth Neufeld. Washington : American Psychological Association Richards, C. (1999). Early childhood preservice teachers’ confidence in singing. Journal of Music Teacher Education, 9(1), 6-17. . Richardson, V.
(2003). Preservice teachers’ beliefs. (T. B.-2. In J. Raths A.C. McAninch (Eds.), Ed.) Greenwich: Connecticut: Information age Publishing. Robson, C. (2002). Real world research: a resource for social scientists and practitionerresearchers (Vol. 2). Blackwell Oxford. Ross, B. Μ. (2010). (B. i. katërt, Ed.) Tiranë: CDE. Robinson, K. (2011). Out of our minds. Chichester, UK: Capstone Publishing Roelofs, E. Sanders, P. (2007). European Journal of vocational training (40),(l), 133-149. Retrieved 15th May, 2015 from https://eric.ed.gov Ryegard, A.; Apelgren, K.; Olsson T. (2010). A Swedish Perspective on Pedagogical Competence, Uppsala University, Division for Development of Teaching and Learning. Online: http://www.upl. umu. 216
KOMPETENCAT E MËSIMDHËNËSVE PËR IDENTIFIKIMIN DHE ZHVILLIMIN E TALENTIT NË MUZIKË se/digitalAssets/45/45329_a-swedish-perspective-on-pedagogicalcompetence.pdf [15 09 2016] Rudi, R. (2002). Sprova estetike. Pejë: Dukagjini. Odunuga, A.F. (2016). Impact of music teachers’ competence on students’ academic achievement at the upper basic level in south west, Nigeria. PhD dissertation submitted to the Arts and Social Science department, Faculty of education, University of Lagos Uhienbeck, A. Μ., Verloop, N., Beijaard, D. (2002). “Requirements for an Assessment Procedure for Beginning Teachers: Implications from Recent Theories on Teaching and Assessment.” Teachers College Record 4104(2), 242—272. Salaman, W. (1983). Living School Music. Cambridge University Press. Saunders, Μ., Thornhill, A. (2009). Research Methods for Business Students. . Harlow: Prentice Hall. Sarah, H. Ronald, G. (2013). Assessment in Music Education: Relationships between Classroom Practice and Professional Publication Topics. Research and Issues in Music Education, 11(1), 1- 14. Snodgrass, J. (2020) Teaching Music Theory - New Voices and Approaches. Published in the United States of America by Oxford University Press 198 Madison Avenue, New York, NY 10016, United States of America. Sharan B. Μ. (2014) Adult learning : linking theory and practice / Sharan B. Merriam, Laura L. Bierema. — First edition. Includes bibliographical references and index. Shively, J. (2015). Constructivism in Music Education. Arts Education Policy Review, 116(3), 128- 136. Susan, H. (2015). Applying Research in Motivation and
Learning to Music Education: What the Experts Say Cogdill. Applications of Research in Music Education, 33(2), 49-57. Sahan, A. (2009). Teacher’s Competence and Students’ Achievement. Retrieved August 2014 from http://anselsahang.blogspot.com/2009/02/ teachers.competence.html Straetmans, G.J.J.M.; Sanders, P.F. (2001). Beoordelen van competenties van docenten. Utrecht: Programmamanagement. Sotirova,M.(2006).Interkulturniaspektinakomunikativnatapedagogicheska kompetentnost Suciu, A.; Mata, L. (2011). Pedagogical Competences - The Key to Efficient Education. International Online Journal of Educational Sciences, Vol. 3(2), p. 411-423. 217
Elizabeta Qarri Scalari, P. C. (2008). La consulenza educativa ai genitori. Bari, Bari: La meridiana. Schwab, J. J. (1978). The practical: A language for curriculum. (S. c-3. In I. Westbury N. J. Wilkof (Eds.), Ed.) Chicago, IL:: University of Chicago Press. Scotland, E. (2013). Curriculum for Excellence. Scotland: From http://www.educationscotland.gov.uk/thecurriculum/ whatiscurriculumforexcellence/ Spahiu, S. (1976). Metodika e mësimit të muzikës. Prishtinë: Libri shkollor. Spinner-Halev, J. (2003). Education, reconciliation and nested identities. Theory and Research in Education, 1(1), 51-72. Stefani, G. (1987). A Theory of Musical Competence. Semiotica, 66. Stokes, Μ. (1998). Ethnicity, Identity and Music - The Musical Construction of Place.Bridgend: WBC Bookbinders. Strauss, C., Quinn, N. (1997). A cognitive theory of cultural meaning. Cambridge, MA:: Cambridge University Press. Stumpf, S. E. (1987). Filozofia Historia Problemet. Tiranë: Toena. Sulejmani, S. (1971). Filozofia dhe artet. Prishtinë: Rilindja. Scott, L. (1992). Attention and perseverance behaviors of preschool children enrolled in Suzuki violin lessons and other activities. Journal of Research in Music Education, 40, 225-235. Sokolov, Μ., (1981). “Vydayuschiesya pianisty pedagogi о nachalnom obuchenii na fotepiano,” (“Outstanding Pianist-Teachers on the Early Stages of Teaching Piano”) in Edited Volume: Rebenok za royalem: pedagogi-pianisty о fortepianoi metodike (A Child at a Piano: Piano Teachers on the Methodology of Teaching Piano), Moscow: Music. Steinberg, Stanley, (1999), “Music training and
mathematics achievement,” Psychoanalytic Review, 86:853-875. Taine, A. H. (2004). “Filozofia e Artit”,. Ideart. Twyman, J., Redding, S. (2015). Personal Competencies, Personalized Learning: Reflection on Instruction. Direct Access: http://www.ccsso. org/Documents/Peer to Peer(O).pdf Teplov, B. Μ. (1985). Psychology of individual differences. Selected Works, 2,211-223 Thi Tran, L. Thi Thanh, L.T. (2018) Teacher Professional Learning in International Education - Practice and Perspectives from the Vocational Education and Training Sector. Palgrave Macmillan imprint is published by Springer Nature 218
KOMPETENCAT E MËSIMDHËNËSVE PËR IDENTIFIKIMIN DHE ZHVILLIMIN E TALENTIT NË MUZIKË Tutolmin, A. (2008). Theoretical and methodological bases of studying the problem of professional and creative competence. Bulletin of the University of the Russian Academy Tavoras, V. (2011). Bnjsimi muzikos mokytojl meninos individualybos raiskos skatinimas taikant projekti melody (Stimulation of expression of artistic individuality of future music teachers by applying method of project). Pedagogika (Educational Science), 103, 74-80. Taebel, D.K. (1990). Is evaluation fair to music educators? Music Educators Journal, 76 (6), 50 Tyshakova, L.T. (2005). Formation of technological competence of the future foreign language teacher (PhD in Ped. Sciences Thesis). Kramatorsk Institute of Economics and Humanities Luhansk, Kramatorsk. URL: http://www.disslib.org/formuvannja-tekhnolohichnoyi-kompetentnostimajbutnoho-vchytelja-inozemnoyi-movy.htm Temmerman, N. (1991). Research Studies in Music Education, 1. Temmerman, N. (1993). School Music Experiences: How Do They Rate? Research Studies in Music Education, 1. Thomas, N. (1989). Class Teaching and Curriculum Support’ in Cullingford, Cedric (ed., 1989) The Primary Teacher. Cassell Educational Limited. Thomas, R. (1997). The Music National Curriculum: Overcoming a compromise. British Journal of Music Education, 14(3). Tillman, J. ( 1988). Music in the Primary School and the National Curriculum. (W. a. in Salaman, Ed.) Association for the Advancement of Teacher Education in Music, p. 81 . Trehub, S. E. (2002). Mothers are musical mentors. Zero to Three,
23,. Trent, S. C., Dixon, D. J. (2004). My eyes were opened: Tracing the conceptual change of pre- service teachers in a special education/ multicultural education course. TeacherEducation and Special Education, 27, 119-133. Trevarthen, C., Malloch, S. (2002). Musicality and music before three. Human vitality and invention shared with pride. Zero to Three, 23,. Ruthmann, S. A., Tobias, E. S., Randles, C., Thibeault, Μ. (2014). Is it the technology? Challenging technological determinism in music education. In C. Randles (Ed.), Music Education: Navigating the Future. New York: Routledge Gradic, R. Letic, Μ. (2008). Porodica kao faktor podsticanja darovitosti, Zbornik radova br.14, Vrsac, Visoka skola strukovih studija za obrazovanje vaspitanja, 184-197. 219
Elizabeta Qarri Закон За Основного Образование (2008). Службен весник на Република Македонка 6poj 103 од 19. 08.2021 година, ww.mon.gov.mk KojoB - БуквиЙ, И. (1989). Методика наставе музичког васпитан а. Београд. Завод за уцбенике и наставна средства. Kertz-Welzel, А. (2008). Music Education in the
Twenty-First Century: A Cross-Cultural Comparison of German and American Music Education towards a New Concept of International Dialogue. Music Education Research, 10(4), 439-449. Kashapova, L., Khaibullina, R. (2015). Development of professional culture in the future music teachers in the
instrumental and performance training. Modern problems of science and education, 5, 26-42. Khaibullina, R. (2011). The model of professional culture development in the bachelors of music education in the process of instrumental training. European Social Science Journal, 4 Kholodnaya, Μ. (2002).
Intelligence as a form of mental experience. Intelligence Psychology: paradoxes of research. St. Petersburg: Peter, 272 p. Kane, M.T. (1992).An argument-based approach to validity. Psychological Bul-letin, 112 (3) Kaloferova, G.; Sotirova, V.; Draganova, R. (2005). Muzika za chetvarti klas, Sofija:
Prosveta Krstic, Μ. Kevereski, Lj. (2015): The impact of socioeconomic status on the occurrence of perfectionism in primary school gifted students. Original scientific paper UDK Коларовска-Гмир^а, В. (1998). Проблеми на почетната музичка настава и нивнот одраз во учебниците за почетното музичко
воспитание и образование во Република Македонка (По Втората светска во)на), (магистерски труд, ракопис), Cronje, ФМУ,
Koren, I. (1990). Nastavnik i nadareni ucenici. Beograd. Arhimedes. Министерство за образование и наука, Биро за разве) на образованието. (2007). КОНЦЕПЦИЛА за деветгодишно основно образоваие и воспитание. Скоп)е. Плавша, Д. (1961). Moje дете и музика. Београд. Народна книга. Pozgaj, J. (1988). Metodika nastave glazbene kulture u osnovnoj skoli. Zagreb. Skolska knjiga. Pozgaj, J. (1975). Metodika glazbenog odgoja u osnovnoj skoli. Zagreb. Prosvjetni sabor 220
KOMPETENCAT E MËSIMDHËNËSVE PËR IDENTIFIKIMIN DHE ZHVILLIMIN E TALENTIT NË MUZIKË Pennington, J., (1925), The importance of being rhythmic. New York: Knickerbocker Press. Timakin, E.M., (1984), Vospitanie pianista, (Upbringing of a pianist), Moskva: Sovetskii kompozitor (Moscow: Soviet Composer). Uçi, A. (1980). “Probleme të estetikës”,. Rilindja. Ucan, A. (1997). Muzik Egitimi: Temel Kavramlar- Ilkeler-Yaklasimlar (2”** ed).Ankara:Muzik Ansiklopedisi Yayinlari. Vasilyeva, N. (2006). Development of music performance competence as a factor of professional training of the future music teachers in the context of pedagogical college. Problems of history, philology and culture, 17, 171-176. Verloop, N. (1999). De leraar: reviewstudie uitgevoerd in opdracht van PROO. Den Haag: NWO/PROO. Westera, W. (2001). Competences in Education: a confusion of tongues. Journal of Curriculum Studies. 33(1), pp.75-88. Westerlund, H. Karlsen, S. Partti, H. (2020) Visions for Intercultural Music Teacher Education - Landscapes: the Arts, Aesthetics, and Education. Volume 26, Springer Nature Switzerland AG Gewerbestrasse 11, 6330 Cham, Switzerland Ward-Steinman, P. Μ. (2010) Becoming a Choral Music - Teacher A Field Experience Workbook. Routledge 2 Park Square, Milton Park, Abingdon, Oxon OX14 4RN Walsh, K. B. (1999). Krijimi i klasave me në qendër femijën Ward, S. (1993). From the National Song Book to the National Curriculum. (J. a. in Glover, Ed.) London: Teaching Music in the Primary School. Cassell, p.26 . Webber, R. (2010). Kurrikulumi dhe vlerësimi i bazuar në Kompetenca. Prishtinë. Wheway,
D. (2006). How is workforce reform affecting music in many primary schools? A timely snapshot. The National Association of Music Educators, 17,. Williamson, N. (1998). A Pretty Sorry State. Times Educational Supplement Friday Magazine. Wong, Μ. (2005). A cross-cultural comparison of teachers’ expressed beliefs about music education and their observed practices in classroom music teaching.Teachers and Teaching, 11(4), 397-418. Woolfolk, A. (2011). Psikologji Edukimi. Tiranë. 221
Elizabeta Qarri Worthen, B., Sanders, J. . (2004). Educational evaluation: Alternative approaches and practical guidelines ((3rd ed.) ed.). Boston: : Allyn Bacon. YOK. (1998). Egitim Fakultesi Ogretmen Yetistirme Lisans Programlari. Ankara: Ankara: YOK. Zadeja, T., Kalemi, S. (1989). Metodika e mësimit të këngës dhe muzikës. Tiranë: Toena Vetlugina, N. A., ( 1968), Myzykalnoe razvitie rebenka (Musical Development of a Child), Moscow: Prosveschenie. Zaffini, E. (2015). Supporting Music Teacher Mentors. Music Educators Journal, 102(1), 69-74. Zhabina, N.A., (2016), “Muzic should be taught to all students, to one extent or another.” https://razvitum.ru/articles/masters/2016-09-21-10-40-42 Nagc, (2022) Gifted Child Quarterly, https://www.nagc.org/resourcespublications/resources/national-standards-gifted-and-talentededucation https://www.maine.gov/doe/sites/maine.gov.doe/files/inlinefiles/ WMEAGiftedandTalentedHandbook.pdf https://www.emc-imc.org/press-news/publications/activity-reports/ пристапено 22.09.2022 222 |
| any_adam_object | 1 |
| author | Qarri, Elizabeta ca. 20./21. Jh |
| author_GND | (DE-588)1338900234 |
| author_facet | Qarri, Elizabeta ca. 20./21. Jh |
| author_role | aut |
| author_sort | Qarri, Elizabeta ca. 20./21. Jh |
| author_variant | e q eq |
| building | Verbundindex |
| bvnumber | BV049787914 |
| ctrlnum | (OCoLC)1450723935 (DE-599)BVBBV049787914 |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>00000nam a2200000 c 4500</leader><controlfield tag="001">BV049787914</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20240814</controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">240719s2024 |||| |||| 00||| alb d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9789951283045</subfield><subfield code="9">978-9951-28-304-5</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1450723935</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV049787914</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">alb</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">OST</subfield><subfield code="q">DE-12</subfield><subfield code="2">fid</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Qarri, Elizabeta</subfield><subfield code="d">ca. 20./21. Jh.</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1338900234</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Kompetencat e mësimdhënësve për identifikimin dhe zhvillimin e talentit në muzikë</subfield><subfield code="c">Dr.Sc. Elizabeta Qarri</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Prishtinë</subfield><subfield code="b">Botime Artini</subfield><subfield code="c">2024</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">238 Seiten</subfield><subfield code="b">Diagramme</subfield><subfield code="c">25 cm</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Musikerziehung</subfield><subfield code="0">(DE-588)4040843-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Begabtenauslese</subfield><subfield code="0">(DE-588)4302632-1</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Albaner</subfield><subfield code="0">(DE-588)4068517-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Kosovo</subfield><subfield code="0">(DE-588)4032571-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Kosovo</subfield><subfield code="0">(DE-588)4032571-4</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Albaner</subfield><subfield code="0">(DE-588)4068517-2</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Musikerziehung</subfield><subfield code="0">(DE-588)4040843-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Begabtenauslese</subfield><subfield code="0">(DE-588)4302632-1</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=035128746&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=035128746&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Literaturverzeichnis</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">oe</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">BSB_NED_20240719</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">780.9</subfield><subfield code="e">22/bsb</subfield><subfield code="f">090513</subfield><subfield code="g">4975</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">370.9</subfield><subfield code="e">22/bsb</subfield><subfield code="f">090513</subfield><subfield code="g">4975</subfield></datafield><datafield tag="943" ind1="1" ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-035128746</subfield></datafield></record></collection> |
| geographic | Kosovo (DE-588)4032571-4 gnd |
| geographic_facet | Kosovo |
| id | DE-604.BV049787914 |
| illustrated | Not Illustrated |
| indexdate | 2024-11-11T09:09:36Z |
| institution | BVB |
| isbn | 9789951283045 |
| language | Albanian |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-035128746 |
| oclc_num | 1450723935 |
| open_access_boolean | |
| owner | DE-12 |
| owner_facet | DE-12 |
| physical | 238 Seiten Diagramme 25 cm |
| psigel | BSB_NED_20240719 |
| publishDate | 2024 |
| publishDateSearch | 2024 |
| publishDateSort | 2024 |
| publisher | Botime Artini |
| record_format | marc |
| spelling | Qarri, Elizabeta ca. 20./21. Jh. Verfasser (DE-588)1338900234 aut Kompetencat e mësimdhënësve për identifikimin dhe zhvillimin e talentit në muzikë Dr.Sc. Elizabeta Qarri Prishtinë Botime Artini 2024 238 Seiten Diagramme 25 cm txt rdacontent n rdamedia nc rdacarrier Musikerziehung (DE-588)4040843-7 gnd rswk-swf Begabtenauslese (DE-588)4302632-1 gnd rswk-swf Albaner (DE-588)4068517-2 gnd rswk-swf Kosovo (DE-588)4032571-4 gnd rswk-swf Kosovo (DE-588)4032571-4 g Albaner (DE-588)4068517-2 s Musikerziehung (DE-588)4040843-7 s Begabtenauslese (DE-588)4302632-1 s DE-604 Digitalisierung BSB München 19 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=035128746&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis Digitalisierung BSB München 19 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=035128746&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA Literaturverzeichnis |
| spellingShingle | Qarri, Elizabeta ca. 20./21. Jh Kompetencat e mësimdhënësve për identifikimin dhe zhvillimin e talentit në muzikë Musikerziehung (DE-588)4040843-7 gnd Begabtenauslese (DE-588)4302632-1 gnd Albaner (DE-588)4068517-2 gnd |
| subject_GND | (DE-588)4040843-7 (DE-588)4302632-1 (DE-588)4068517-2 (DE-588)4032571-4 |
| title | Kompetencat e mësimdhënësve për identifikimin dhe zhvillimin e talentit në muzikë |
| title_auth | Kompetencat e mësimdhënësve për identifikimin dhe zhvillimin e talentit në muzikë |
| title_exact_search | Kompetencat e mësimdhënësve për identifikimin dhe zhvillimin e talentit në muzikë |
| title_full | Kompetencat e mësimdhënësve për identifikimin dhe zhvillimin e talentit në muzikë Dr.Sc. Elizabeta Qarri |
| title_fullStr | Kompetencat e mësimdhënësve për identifikimin dhe zhvillimin e talentit në muzikë Dr.Sc. Elizabeta Qarri |
| title_full_unstemmed | Kompetencat e mësimdhënësve për identifikimin dhe zhvillimin e talentit në muzikë Dr.Sc. Elizabeta Qarri |
| title_short | Kompetencat e mësimdhënësve për identifikimin dhe zhvillimin e talentit në muzikë |
| title_sort | kompetencat e mesimdhenesve per identifikimin dhe zhvillimin e talentit ne muzike |
| topic | Musikerziehung (DE-588)4040843-7 gnd Begabtenauslese (DE-588)4302632-1 gnd Albaner (DE-588)4068517-2 gnd |
| topic_facet | Musikerziehung Begabtenauslese Albaner Kosovo |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=035128746&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=035128746&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT qarrielizabeta kompetencatemesimdhenesveperidentifikimindhezhvilliminetalentitnemuzike |