The Asia Pacific War: impact, legacy, and reconciliation
"This book examines key aspects of the Asia Pacific War (1931-1945), that was initially waged between Japan and China, before Japan's attack on Pearl Harbor drew in the U.S.-led allied forces from 1941 to 1945. The first half of the book examines three interlocking components, the origins...
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
London ; New York
Routledge
[2024]
|
| Schriftenreihe: | Routledge studies in the modern history of Asia
181 |
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Zusammenfassung: | "This book examines key aspects of the Asia Pacific War (1931-1945), that was initially waged between Japan and China, before Japan's attack on Pearl Harbor drew in the U.S.-led allied forces from 1941 to 1945. The first half of the book examines three interlocking components, the origins of the war; its impact on combatants and civilians; and its short-term legacy, including the huge changes that took place in the postwar governance of Japan. Part 2 explores the ongoing impact and legacy of the war for those in postwar Japan, and later generations, particularly through the examination of the ambiguity of state-led reconciliation with Japan's neighbors, the growth of dynamic civil reconciliation efforts, and the prominent role of the arts in peace movements. Through a people-centered approach it filters historical events through the lens of the war's impact on individuals, who found themselves players within a larger frame of the social history of Japan and caught up in the international power dynamics of the nuclear age. Featuring studies of contemporary peace activism, this will be a valuable resource to students and scholars of Modern Asian and U.S. History, as well as those interested in post-war memory and reconciliation"-- |
| Beschreibung: | xxvii, 242 Seiten Illustrationen, Karte 25 cm |
| ISBN: | 9781138222342 |
Internformat
MARC
| LEADER | 00000nam a2200000 cb4500 | ||
|---|---|---|---|
| 001 | BV049354650 | ||
| 003 | DE-604 | ||
| 005 | 20231124 | ||
| 007 | t | ||
| 008 | 231009s2024 a||| b||| 00||| eng d | ||
| 020 | |a 9781138222342 |c hb |9 978-1-138-22234-2 | ||
| 035 | |a (OCoLC)1410705471 | ||
| 035 | |a (DE-599)BVBBV049354650 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-12 | ||
| 084 | |a HIST |q DE-12 |2 fid | ||
| 100 | 1 | |a Claremont, Yasuko |d 1944- |e Verfasser |0 (DE-588)140767363 |4 aut | |
| 245 | 1 | 0 | |a The Asia Pacific War |b impact, legacy, and reconciliation |c Yasuko Claremont |
| 264 | 1 | |a London ; New York |b Routledge |c [2024] | |
| 300 | |a xxvii, 242 Seiten |b Illustrationen, Karte |c 25 cm | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 1 | |a Routledge studies in the modern history of Asia |v 181 | |
| 505 | 8 | |a Part I: The Asia Pacific War -- Introduction: Is there, or was there, a so-called 'Just War'? -- The Origins of the Asia Pacific War: 'Honor, Fear, Self-interest' -- The Human Impact of the Asia Pacific War -- The Legacies of the Asia Pacific War -- the Atomic Bombings and Article 9 -- Part II : Postwar Reconciliation Introduction: Aspects of Reconciliation -- Reparations, Memorials and Reconciliation at State Level -- Citizens' Reconciliation -- Postwar Reconciliation Through the Arts | |
| 520 | 3 | |a "This book examines key aspects of the Asia Pacific War (1931-1945), that was initially waged between Japan and China, before Japan's attack on Pearl Harbor drew in the U.S.-led allied forces from 1941 to 1945. The first half of the book examines three interlocking components, the origins of the war; its impact on combatants and civilians; and its short-term legacy, including the huge changes that took place in the postwar governance of Japan. Part 2 explores the ongoing impact and legacy of the war for those in postwar Japan, and later generations, particularly through the examination of the ambiguity of state-led reconciliation with Japan's neighbors, the growth of dynamic civil reconciliation efforts, and the prominent role of the arts in peace movements. Through a people-centered approach it filters historical events through the lens of the war's impact on individuals, who found themselves players within a larger frame of the social history of Japan and caught up in the international power dynamics of the nuclear age. Featuring studies of contemporary peace activism, this will be a valuable resource to students and scholars of Modern Asian and U.S. History, as well as those interested in post-war memory and reconciliation"-- | |
| 648 | 7 | |a Geschichte 1931-1945 |2 gnd |9 rswk-swf | |
| 648 | 7 | |a Geschichte 1952- |2 gnd |9 rswk-swf | |
| 650 | 0 | 7 | |a Versöhnung |0 (DE-588)4063213-1 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Vergangenheitsbewältigung |0 (DE-588)4061672-1 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Pazifikkrieg |g 1941-1945 |0 (DE-588)4249775-9 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Japanisch-Chinesischer Krieg |g 1937-1945 |0 (DE-588)4073002-5 |2 gnd |9 rswk-swf |
| 651 | 7 | |a Japan |0 (DE-588)4028495-5 |2 gnd |9 rswk-swf | |
| 653 | 0 | |a Asia Pacific War, 1931-1945 | |
| 653 | 0 | |a World War, 1939-1945 / Pacific Area | |
| 653 | 0 | |a World War, 1939-1945 / Asia | |
| 653 | 0 | |a Guerre mondiale, 1939-1945 / Pacifique, Région du | |
| 653 | 0 | |a Guerre mondiale, 1939-1945 / Asie | |
| 653 | 2 | |a Asia | |
| 653 | 2 | |a Pacific Area | |
| 653 | 4 | |a 1931-1945 | |
| 689 | 0 | 0 | |a Japanisch-Chinesischer Krieg |g 1937-1945 |0 (DE-588)4073002-5 |D s |
| 689 | 0 | 1 | |a Pazifikkrieg |g 1941-1945 |0 (DE-588)4249775-9 |D s |
| 689 | 0 | 2 | |a Geschichte 1931-1945 |A z |
| 689 | 0 | |5 DE-604 | |
| 689 | 1 | 0 | |a Japan |0 (DE-588)4028495-5 |D g |
| 689 | 1 | 1 | |a Vergangenheitsbewältigung |0 (DE-588)4061672-1 |D s |
| 689 | 1 | 2 | |a Versöhnung |0 (DE-588)4063213-1 |D s |
| 689 | 1 | 3 | |a Geschichte 1952- |A z |
| 689 | 1 | |5 DE-604 | |
| 775 | 0 | 8 | |i Erscheint auch las |n Druck-Ausgabe, Paperback |z 978-1-032-50904-4 |
| 776 | 0 | 8 | |i Erscheint auch als |n Online-Ausgabe |z 978-1-315-40802-6 |
| 830 | 0 | |a Routledge studies in the modern history of Asia |v 181 |w (DE-604)BV012703327 |9 181 | |
| 856 | 4 | 2 | |m Digitalisierung BSB München - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=034614929&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 940 | 1 | |q BSB_NED_20231124 | |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-034614929 | ||
| 942 | 1 | 1 | |c 355.009 |e 22/bsb |f 09044 |g 5 |
| 942 | 1 | 1 | |c 355.009 |e 22/bsb |f 09043 |g 51 |
| 942 | 1 | 1 | |c 355.009 |e 22/bsb |f 09043 |g 52 |
| 942 | 1 | 1 | |c 907.2 |e 22/bsb |f 0904 |g 52 |
| 942 | 1 | 1 | |c 355.009 |e 22/bsb |f 09044 |g 52 |
Datensatz im Suchindex
| _version_ | 1804185889954332672 |
|---|---|
| adam_text | Contents Dedication Author ’s note List of Tables List ofFigures Preface Acknowledgments General Introduction: Japan ’s Peace Paradox v viii ix x xi xv xvi PARTI The Asia Pacific War 1 Introduction: Is There, or Was There, a So-Called Just War? 3 1 The Origins of the Asia Pacific War: ‘Honour, Fear, Self-Interesf 5 2 The Human Impact of the Asia Pacific War 47 3 Legacies of the Asia Pacific War: The Atomic Bombings and Article 9 71 PART II Postwar Reconciliation 105 Introduction: Aspects of Reconciliation 107 4 Reparation, Memorials, and Reconciliation at the State Level 110 5 Citizens’ Reconciliation 142 6 Postwar Reconciliation through the Arts 7 Epilogue: The Rise of Citizen Power in Support of the Spirit of Article 9 Index 174 220 236
|
| adam_txt |
Contents Dedication Author ’s note List of Tables List ofFigures Preface Acknowledgments General Introduction: Japan ’s Peace Paradox v viii ix x xi xv xvi PARTI The Asia Pacific War 1 Introduction: Is There, or Was There, a So-Called Just War? 3 1 The Origins of the Asia Pacific War: ‘Honour, Fear, Self-Interesf 5 2 The Human Impact of the Asia Pacific War 47 3 Legacies of the Asia Pacific War: The Atomic Bombings and Article 9 71 PART II Postwar Reconciliation 105 Introduction: Aspects of Reconciliation 107 4 Reparation, Memorials, and Reconciliation at the State Level 110 5 Citizens’ Reconciliation 142 6 Postwar Reconciliation through the Arts 7 Epilogue: The Rise of Citizen Power in Support of the Spirit of Article 9 Index 174 220 236 |
| any_adam_object | 1 |
| any_adam_object_boolean | 1 |
| author | Claremont, Yasuko 1944- |
| author_GND | (DE-588)140767363 |
| author_facet | Claremont, Yasuko 1944- |
| author_role | aut |
| author_sort | Claremont, Yasuko 1944- |
| author_variant | y c yc |
| building | Verbundindex |
| bvnumber | BV049354650 |
| contents | Part I: The Asia Pacific War -- Introduction: Is there, or was there, a so-called 'Just War'? -- The Origins of the Asia Pacific War: 'Honor, Fear, Self-interest' -- The Human Impact of the Asia Pacific War -- The Legacies of the Asia Pacific War -- the Atomic Bombings and Article 9 -- Part II : Postwar Reconciliation Introduction: Aspects of Reconciliation -- Reparations, Memorials and Reconciliation at State Level -- Citizens' Reconciliation -- Postwar Reconciliation Through the Arts |
| ctrlnum | (OCoLC)1410705471 (DE-599)BVBBV049354650 |
| era | Geschichte 1931-1945 gnd Geschichte 1952- gnd |
| era_facet | Geschichte 1931-1945 Geschichte 1952- |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>04657nam a2200709 cb4500</leader><controlfield tag="001">BV049354650</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20231124 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">231009s2024 a||| b||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781138222342</subfield><subfield code="c">hb</subfield><subfield code="9">978-1-138-22234-2</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1410705471</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV049354650</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">HIST</subfield><subfield code="q">DE-12</subfield><subfield code="2">fid</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Claremont, Yasuko</subfield><subfield code="d">1944-</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)140767363</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">The Asia Pacific War</subfield><subfield code="b">impact, legacy, and reconciliation</subfield><subfield code="c">Yasuko Claremont</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">London ; New York</subfield><subfield code="b">Routledge</subfield><subfield code="c">[2024]</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">xxvii, 242 Seiten</subfield><subfield code="b">Illustrationen, Karte</subfield><subfield code="c">25 cm</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Routledge studies in the modern history of Asia</subfield><subfield code="v">181</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Part I: The Asia Pacific War -- Introduction: Is there, or was there, a so-called 'Just War'? -- The Origins of the Asia Pacific War: 'Honor, Fear, Self-interest' -- The Human Impact of the Asia Pacific War -- The Legacies of the Asia Pacific War -- the Atomic Bombings and Article 9 -- Part II : Postwar Reconciliation Introduction: Aspects of Reconciliation -- Reparations, Memorials and Reconciliation at State Level -- Citizens' Reconciliation -- Postwar Reconciliation Through the Arts</subfield></datafield><datafield tag="520" ind1="3" ind2=" "><subfield code="a">"This book examines key aspects of the Asia Pacific War (1931-1945), that was initially waged between Japan and China, before Japan's attack on Pearl Harbor drew in the U.S.-led allied forces from 1941 to 1945. The first half of the book examines three interlocking components, the origins of the war; its impact on combatants and civilians; and its short-term legacy, including the huge changes that took place in the postwar governance of Japan. Part 2 explores the ongoing impact and legacy of the war for those in postwar Japan, and later generations, particularly through the examination of the ambiguity of state-led reconciliation with Japan's neighbors, the growth of dynamic civil reconciliation efforts, and the prominent role of the arts in peace movements. Through a people-centered approach it filters historical events through the lens of the war's impact on individuals, who found themselves players within a larger frame of the social history of Japan and caught up in the international power dynamics of the nuclear age. Featuring studies of contemporary peace activism, this will be a valuable resource to students and scholars of Modern Asian and U.S. History, as well as those interested in post-war memory and reconciliation"--</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte 1931-1945</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte 1952-</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Versöhnung</subfield><subfield code="0">(DE-588)4063213-1</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Vergangenheitsbewältigung</subfield><subfield code="0">(DE-588)4061672-1</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Pazifikkrieg</subfield><subfield code="g">1941-1945</subfield><subfield code="0">(DE-588)4249775-9</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Japanisch-Chinesischer Krieg</subfield><subfield code="g">1937-1945</subfield><subfield code="0">(DE-588)4073002-5</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Japan</subfield><subfield code="0">(DE-588)4028495-5</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">Asia Pacific War, 1931-1945</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">World War, 1939-1945 / Pacific Area</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">World War, 1939-1945 / Asia</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">Guerre mondiale, 1939-1945 / Pacifique, Région du</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">Guerre mondiale, 1939-1945 / Asie</subfield></datafield><datafield tag="653" ind1=" " ind2="2"><subfield code="a">Asia</subfield></datafield><datafield tag="653" ind1=" " ind2="2"><subfield code="a">Pacific Area</subfield></datafield><datafield tag="653" ind1=" " ind2="4"><subfield code="a">1931-1945</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Japanisch-Chinesischer Krieg</subfield><subfield code="g">1937-1945</subfield><subfield code="0">(DE-588)4073002-5</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Pazifikkrieg</subfield><subfield code="g">1941-1945</subfield><subfield code="0">(DE-588)4249775-9</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Geschichte 1931-1945</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="1" ind2="0"><subfield code="a">Japan</subfield><subfield code="0">(DE-588)4028495-5</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="1" ind2="1"><subfield code="a">Vergangenheitsbewältigung</subfield><subfield code="0">(DE-588)4061672-1</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="2"><subfield code="a">Versöhnung</subfield><subfield code="0">(DE-588)4063213-1</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="3"><subfield code="a">Geschichte 1952-</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="1" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="775" ind1="0" ind2="8"><subfield code="i">Erscheint auch las</subfield><subfield code="n">Druck-Ausgabe, Paperback</subfield><subfield code="z">978-1-032-50904-4</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Online-Ausgabe</subfield><subfield code="z">978-1-315-40802-6</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Routledge studies in the modern history of Asia</subfield><subfield code="v">181</subfield><subfield code="w">(DE-604)BV012703327</subfield><subfield code="9">181</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=034614929&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">BSB_NED_20231124</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-034614929</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">355.009</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09044</subfield><subfield code="g">5</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">355.009</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09043</subfield><subfield code="g">51</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">355.009</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09043</subfield><subfield code="g">52</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">907.2</subfield><subfield code="e">22/bsb</subfield><subfield code="f">0904</subfield><subfield code="g">52</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">355.009</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09044</subfield><subfield code="g">52</subfield></datafield></record></collection> |
| geographic | Japan (DE-588)4028495-5 gnd |
| geographic_facet | Japan |
| id | DE-604.BV049354650 |
| illustrated | Illustrated |
| index_date | 2024-07-03T22:50:51Z |
| indexdate | 2024-07-10T10:02:25Z |
| institution | BVB |
| isbn | 9781138222342 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-034614929 |
| oclc_num | 1410705471 |
| open_access_boolean | |
| owner | DE-12 |
| owner_facet | DE-12 |
| physical | xxvii, 242 Seiten Illustrationen, Karte 25 cm |
| psigel | BSB_NED_20231124 |
| publishDate | 2024 |
| publishDateSearch | 2024 |
| publishDateSort | 2024 |
| publisher | Routledge |
| record_format | marc |
| series | Routledge studies in the modern history of Asia |
| series2 | Routledge studies in the modern history of Asia |
| spelling | Claremont, Yasuko 1944- Verfasser (DE-588)140767363 aut The Asia Pacific War impact, legacy, and reconciliation Yasuko Claremont London ; New York Routledge [2024] xxvii, 242 Seiten Illustrationen, Karte 25 cm txt rdacontent n rdamedia nc rdacarrier Routledge studies in the modern history of Asia 181 Part I: The Asia Pacific War -- Introduction: Is there, or was there, a so-called 'Just War'? -- The Origins of the Asia Pacific War: 'Honor, Fear, Self-interest' -- The Human Impact of the Asia Pacific War -- The Legacies of the Asia Pacific War -- the Atomic Bombings and Article 9 -- Part II : Postwar Reconciliation Introduction: Aspects of Reconciliation -- Reparations, Memorials and Reconciliation at State Level -- Citizens' Reconciliation -- Postwar Reconciliation Through the Arts "This book examines key aspects of the Asia Pacific War (1931-1945), that was initially waged between Japan and China, before Japan's attack on Pearl Harbor drew in the U.S.-led allied forces from 1941 to 1945. The first half of the book examines three interlocking components, the origins of the war; its impact on combatants and civilians; and its short-term legacy, including the huge changes that took place in the postwar governance of Japan. Part 2 explores the ongoing impact and legacy of the war for those in postwar Japan, and later generations, particularly through the examination of the ambiguity of state-led reconciliation with Japan's neighbors, the growth of dynamic civil reconciliation efforts, and the prominent role of the arts in peace movements. Through a people-centered approach it filters historical events through the lens of the war's impact on individuals, who found themselves players within a larger frame of the social history of Japan and caught up in the international power dynamics of the nuclear age. Featuring studies of contemporary peace activism, this will be a valuable resource to students and scholars of Modern Asian and U.S. History, as well as those interested in post-war memory and reconciliation"-- Geschichte 1931-1945 gnd rswk-swf Geschichte 1952- gnd rswk-swf Versöhnung (DE-588)4063213-1 gnd rswk-swf Vergangenheitsbewältigung (DE-588)4061672-1 gnd rswk-swf Pazifikkrieg 1941-1945 (DE-588)4249775-9 gnd rswk-swf Japanisch-Chinesischer Krieg 1937-1945 (DE-588)4073002-5 gnd rswk-swf Japan (DE-588)4028495-5 gnd rswk-swf Asia Pacific War, 1931-1945 World War, 1939-1945 / Pacific Area World War, 1939-1945 / Asia Guerre mondiale, 1939-1945 / Pacifique, Région du Guerre mondiale, 1939-1945 / Asie Asia Pacific Area 1931-1945 Japanisch-Chinesischer Krieg 1937-1945 (DE-588)4073002-5 s Pazifikkrieg 1941-1945 (DE-588)4249775-9 s Geschichte 1931-1945 z DE-604 Japan (DE-588)4028495-5 g Vergangenheitsbewältigung (DE-588)4061672-1 s Versöhnung (DE-588)4063213-1 s Geschichte 1952- z Erscheint auch las Druck-Ausgabe, Paperback 978-1-032-50904-4 Erscheint auch als Online-Ausgabe 978-1-315-40802-6 Routledge studies in the modern history of Asia 181 (DE-604)BV012703327 181 Digitalisierung BSB München - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=034614929&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Claremont, Yasuko 1944- The Asia Pacific War impact, legacy, and reconciliation Routledge studies in the modern history of Asia Part I: The Asia Pacific War -- Introduction: Is there, or was there, a so-called 'Just War'? -- The Origins of the Asia Pacific War: 'Honor, Fear, Self-interest' -- The Human Impact of the Asia Pacific War -- The Legacies of the Asia Pacific War -- the Atomic Bombings and Article 9 -- Part II : Postwar Reconciliation Introduction: Aspects of Reconciliation -- Reparations, Memorials and Reconciliation at State Level -- Citizens' Reconciliation -- Postwar Reconciliation Through the Arts Versöhnung (DE-588)4063213-1 gnd Vergangenheitsbewältigung (DE-588)4061672-1 gnd Pazifikkrieg 1941-1945 (DE-588)4249775-9 gnd Japanisch-Chinesischer Krieg 1937-1945 (DE-588)4073002-5 gnd |
| subject_GND | (DE-588)4063213-1 (DE-588)4061672-1 (DE-588)4249775-9 (DE-588)4073002-5 (DE-588)4028495-5 |
| title | The Asia Pacific War impact, legacy, and reconciliation |
| title_auth | The Asia Pacific War impact, legacy, and reconciliation |
| title_exact_search | The Asia Pacific War impact, legacy, and reconciliation |
| title_exact_search_txtP | The Asia Pacific War impact, legacy, and reconciliation |
| title_full | The Asia Pacific War impact, legacy, and reconciliation Yasuko Claremont |
| title_fullStr | The Asia Pacific War impact, legacy, and reconciliation Yasuko Claremont |
| title_full_unstemmed | The Asia Pacific War impact, legacy, and reconciliation Yasuko Claremont |
| title_short | The Asia Pacific War |
| title_sort | the asia pacific war impact legacy and reconciliation |
| title_sub | impact, legacy, and reconciliation |
| topic | Versöhnung (DE-588)4063213-1 gnd Vergangenheitsbewältigung (DE-588)4061672-1 gnd Pazifikkrieg 1941-1945 (DE-588)4249775-9 gnd Japanisch-Chinesischer Krieg 1937-1945 (DE-588)4073002-5 gnd |
| topic_facet | Versöhnung Vergangenheitsbewältigung Pazifikkrieg 1941-1945 Japanisch-Chinesischer Krieg 1937-1945 Japan |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=034614929&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| volume_link | (DE-604)BV012703327 |
| work_keys_str_mv | AT claremontyasuko theasiapacificwarimpactlegacyandreconciliation |