Physician crisis: why physicians are leaving medicine, why you should stay, and how to be happy
Chapter 1. The Nature of the Problem -- Chapter 2. Getting into Medical School -- Chapter 3. Financing Medical School -- Chapter 4. Medical School Curriculum -- Chapter 5. Post Medical School Graduate Training -- Chapter 6. Jobs -- Chapter 7. Electronic Medical Records (EMR) -- Chapter 8. Physician...
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
Cham
Springer
[2023]
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis Klappentext |
| Zusammenfassung: | Chapter 1. The Nature of the Problem -- Chapter 2. Getting into Medical School -- Chapter 3. Financing Medical School -- Chapter 4. Medical School Curriculum -- Chapter 5. Post Medical School Graduate Training -- Chapter 6. Jobs -- Chapter 7. Electronic Medical Records (EMR) -- Chapter 8. Physician "Burnout" -- Chapter 9. Getting Paid – Medicare/Medicaid/Private Insurance Companies -- Chapter 10. What are the Customer Experience Challenges in Healthcare? -- Chapter 11. Drug Pricing -- Chapter 12. "Malpractice" -- Chapter 13. Hospital Employment -- Chapter14. Private Equity -- Chapter 15. What Country has the Best Healthcare? -- Chapter 16. Health Insurance Portability and Accountability Act (HIPAA) -- Chapter 17. Political Influence -- Chapter 18. Possible Solutions -- Chapter 19. Summary. . This book is the first volume to individually dissect and explore the reasons physicians are leaving medicine. It lays out potential solutions to many of the problems, which will result in a happier practicing physician. Chapters begin with the nature of the problem, and go through a physician's life cycle on the job, from medical school through post-grad and onwards. Chapters will also cover issues as a practicing physician and how to help alleviate these problems. The book ends with potential solutions to the issue of physician burnout. Physician Burnout: Why Doctors Are Leaving Medicine and How to Fix It is a must-have resource for practicing physicians, healthcare providers, and healthcare management. It is also a great resource for medical school students and those looking to get into the healthcare field. . |
| Beschreibung: | xiii, 110 Seiten |
| ISBN: | 9783031279782 |
Internformat
MARC
| LEADER | 00000nam a22000001c 4500 | ||
|---|---|---|---|
| 001 | BV048972804 | ||
| 003 | DE-604 | ||
| 005 | 20230630 | ||
| 007 | t | ||
| 008 | 230524s2023 sz |||| 00||| eng d | ||
| 020 | |a 9783031279782 |9 978-3-031-27978-2 | ||
| 035 | |a (OCoLC)1385302212 | ||
| 035 | |a (DE-599)BVBBV048972804 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng | |
| 044 | |a sz |c XA-CH | ||
| 049 | |a DE-384 | ||
| 082 | 0 | |a 610 |2 23 | |
| 084 | |a XF 1200 |0 (DE-625)152688: |2 rvk | ||
| 100 | 1 | |a Weiss, Jeffrey N. |e Verfasser |0 (DE-588)1256039845 |4 aut | |
| 245 | 1 | 0 | |a Physician crisis |b why physicians are leaving medicine, why you should stay, and how to be happy |c Jeffrey N. Weiss |
| 264 | 1 | |a Cham |b Springer |c [2023] | |
| 300 | |a xiii, 110 Seiten | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 520 | 3 | |a Chapter 1. The Nature of the Problem -- Chapter 2. Getting into Medical School -- Chapter 3. Financing Medical School -- Chapter 4. Medical School Curriculum -- Chapter 5. Post Medical School Graduate Training -- Chapter 6. Jobs -- Chapter 7. Electronic Medical Records (EMR) -- Chapter 8. Physician "Burnout" -- Chapter 9. Getting Paid – Medicare/Medicaid/Private Insurance Companies -- Chapter 10. What are the Customer Experience Challenges in Healthcare? -- Chapter 11. Drug Pricing -- Chapter 12. "Malpractice" -- Chapter 13. Hospital Employment -- Chapter14. Private Equity -- Chapter 15. What Country has the Best Healthcare? -- Chapter 16. Health Insurance Portability and Accountability Act (HIPAA) -- Chapter 17. Political Influence -- Chapter 18. Possible Solutions -- Chapter 19. Summary. . | |
| 520 | 3 | |a This book is the first volume to individually dissect and explore the reasons physicians are leaving medicine. It lays out potential solutions to many of the problems, which will result in a happier practicing physician. Chapters begin with the nature of the problem, and go through a physician's life cycle on the job, from medical school through post-grad and onwards. Chapters will also cover issues as a practicing physician and how to help alleviate these problems. The book ends with potential solutions to the issue of physician burnout. Physician Burnout: Why Doctors Are Leaving Medicine and How to Fix It is a must-have resource for practicing physicians, healthcare providers, and healthcare management. It is also a great resource for medical school students and those looking to get into the healthcare field. . | |
| 650 | 0 | 7 | |a Berufsbild |0 (DE-588)4069340-5 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Arzt |0 (DE-588)4003157-3 |2 gnd |9 rswk-swf |
| 653 | 0 | |a Medicine. | |
| 689 | 0 | 0 | |a Arzt |0 (DE-588)4003157-3 |D s |
| 689 | 0 | 1 | |a Berufsbild |0 (DE-588)4069340-5 |D s |
| 689 | 0 | |5 DE-604 | |
| 776 | 0 | 8 | |i Erscheint auch als |n Online-Ausgabe |z 978-3-031-27979-9 |
| 856 | 4 | 2 | |m Digitalisierung UB Augsburg - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=034236391&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 856 | 4 | 2 | |m Digitalisierung UB Augsburg - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=034236391&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |3 Klappentext |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-034236391 | ||
Datensatz im Suchindex
| _version_ | 1804185213545218048 |
|---|---|
| adam_text | Contents 1 The Nature of the Problem......................................... 1.1 Burnout............................................................ 1.2 Bureaucracy.................................................... 1.3 Loss of Independence..................................... 1.4 Electronic Medical Records (EMR)............... 1.5 Long Hours...................................................... 1.6 Low Income.................................................... 1.7 Patient Bullying............................................... Suggested Readings 2 Getting into Medical School...................................... 2.1 2022 Admissions............................................... Suggested Reading 3 4 1 1 1 2 2 2 2 3 5 9 9 10 3.1 How Much Will You Earn?............................ 3.2 Doximity Survey............................................. 3.3 Lowest Salaries............................................... Suggested Reading 11 11 13 14 15 Medical School Curriculum........................................ 17 How Has the Medical School Curriculum Changed Over the Years?........... 4.2 Curriculum Change in Medical Schools.......... Suggested Reading 17 18 19 Financing Medical School........................................... 4.1 5 Post Medical School Graduate Training.................. Suggested Reading 21 22
xii Contents 6 Jobs................................................................................ 6.1 Hospital Employment.......................................... Suggested Reading ți 2J 25 7 Electronic Medical Records (EMR)......................... Suggested Reading շ7 2$ 8՜ *Ч?иГПОШЛ Suggested Reading 24 9 Getting Paid by Insurance........................................... 9,1 Medicare................................................................ Suggested Reading 10 351 What Are the Customer Experience Challenges in Healthcare?............................................ Suggested Reading 11 Drug Pricing.................................................................. 11.1 Have Prescription Prices Decreased Under the Trump Administration?.......... 54 11.2 Best-Selling Prescription Drugs by Worldwide Revenue Under President Trump.................................................... 11.3 Best-Selling Prescription Drugs by Worldwide Revenue Under President Obama......................................... 56 Suggested Reading 35 36 37 44 42 55 58 12 “Malpractice”.............................................................. Suggested Reading 61 64 13 Private Equity.............................................................. Suggested Reading 69 70 14 What Country Has the Best Healthcare in the World?.................................................................. 14.1 United States Healthcare.................................... 14.1.1 U.S.............................................................. Suggested Reading 71 73 73 77
Contents xiii The Health Insurance Portability and Accountability Act (HIPAA)............................. 15.1 HIPPA’s Effect on Research............................... Suggested Reading 79 80 81 16 Political Interference................................................... 16.1 Corruptions Perceptions Index (CPI)............... Suggested Reading 83 84 88 15 17 Miscellaneous—Other Thoughts.............................. 89 18 Possible Solutions......................................................... 95 19 Summary........................................................................ 101 20 This May Save Your Life............................................. 103 21 Conclusion...................................................................... 105 Index....................................................................................... 107
Jeffrey N. Weiss Physician Crisis Why Physicians Are Leaving Medicine, Why You Should Stay, and How To Be Happy This book is the first volume to individually dissect and explore the reasons physicians are leaving medicine. It lays out potential solutions to many of the problems, which will result in a happier practicing physician. Chapters begin with the nature of the problem, and go through a physician’s life cycle on the job, from medical school through post-grad and onwards. Chapters will also cover issues as a practicing physician and how to help alleviate these problems. The book ends with potential solutions to the issue of physician burnout. Physician Crisis: Why Physicians Are Leaving Medicine, Why You Should Stay, and How To Be Happy is a must-have resource for practicing physicians, healthcare providers, and healthcare management. It is also a great resource for medical school students and those looking to get into the healthcare field.
|
| adam_txt |
Contents 1 The Nature of the Problem. 1.1 Burnout. 1.2 Bureaucracy. 1.3 Loss of Independence. 1.4 Electronic Medical Records (EMR). 1.5 Long Hours. 1.6 Low Income. 1.7 Patient Bullying. Suggested Readings 2 Getting into Medical School. 2.1 2022 Admissions. Suggested Reading 3 4 1 1 1 2 2 2 2 3 5 9 9 10 3.1 How Much Will You Earn?. 3.2 Doximity Survey. 3.3 Lowest Salaries. Suggested Reading 11 11 13 14 15 Medical School Curriculum. 17 How Has the Medical School Curriculum Changed Over the Years?. 4.2 Curriculum Change in Medical Schools. Suggested Reading 17 18 19 Financing Medical School. 4.1 5 Post Medical School Graduate Training. Suggested Reading 21 22
xii Contents 6 Jobs. 6.1 Hospital Employment. Suggested Reading ți 2J 25 7 Electronic Medical Records (EMR). Suggested Reading շ7 2$ 8՜ *Ч?иГПОШЛ Suggested Reading 24 9 Getting Paid by Insurance. 9,1 Medicare. Suggested Reading 10 351 What Are the Customer Experience Challenges in Healthcare?. Suggested Reading 11 Drug Pricing. 11.1 Have Prescription Prices Decreased Under the Trump Administration?. 54 11.2 Best-Selling Prescription Drugs by Worldwide Revenue Under President Trump. 11.3 Best-Selling Prescription Drugs by Worldwide Revenue Under President Obama. 56 Suggested Reading 35 36 37 44 42 55 58 12 “Malpractice”. Suggested Reading 61 64 13 Private Equity. Suggested Reading 69 70 14 What Country Has the Best Healthcare in the World?. 14.1 United States Healthcare. 14.1.1 U.S. Suggested Reading 71 73 73 77
Contents xiii The Health Insurance Portability and Accountability Act (HIPAA). 15.1 HIPPA’s Effect on Research. Suggested Reading 79 80 81 16 Political Interference. 16.1 Corruptions Perceptions Index (CPI). Suggested Reading 83 84 88 15 17 Miscellaneous—Other Thoughts. 89 18 Possible Solutions. 95 19 Summary. 101 20 This May Save Your Life. 103 21 Conclusion. 105 Index. 107
Jeffrey N. Weiss Physician Crisis Why Physicians Are Leaving Medicine, Why You Should Stay, and How To Be Happy This book is the first volume to individually dissect and explore the reasons physicians are leaving medicine. It lays out potential solutions to many of the problems, which will result in a happier practicing physician. Chapters begin with the nature of the problem, and go through a physician’s life cycle on the job, from medical school through post-grad and onwards. Chapters will also cover issues as a practicing physician and how to help alleviate these problems. The book ends with potential solutions to the issue of physician burnout. Physician Crisis: Why Physicians Are Leaving Medicine, Why You Should Stay, and How To Be Happy is a must-have resource for practicing physicians, healthcare providers, and healthcare management. It is also a great resource for medical school students and those looking to get into the healthcare field. |
| any_adam_object | 1 |
| any_adam_object_boolean | 1 |
| author | Weiss, Jeffrey N. |
| author_GND | (DE-588)1256039845 |
| author_facet | Weiss, Jeffrey N. |
| author_role | aut |
| author_sort | Weiss, Jeffrey N. |
| author_variant | j n w jn jnw |
| building | Verbundindex |
| bvnumber | BV048972804 |
| classification_rvk | XF 1200 |
| ctrlnum | (OCoLC)1385302212 (DE-599)BVBBV048972804 |
| dewey-full | 610 |
| dewey-hundreds | 600 - Technology (Applied sciences) |
| dewey-ones | 610 - Medicine and health |
| dewey-raw | 610 |
| dewey-search | 610 |
| dewey-sort | 3610 |
| dewey-tens | 610 - Medicine and health |
| discipline | Medizin |
| discipline_str_mv | Medizin |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>03421nam a22004211c 4500</leader><controlfield tag="001">BV048972804</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20230630 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">230524s2023 sz |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783031279782</subfield><subfield code="9">978-3-031-27978-2</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1385302212</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV048972804</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">sz</subfield><subfield code="c">XA-CH</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-384</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">610</subfield><subfield code="2">23</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">XF 1200</subfield><subfield code="0">(DE-625)152688:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Weiss, Jeffrey N.</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1256039845</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Physician crisis</subfield><subfield code="b">why physicians are leaving medicine, why you should stay, and how to be happy</subfield><subfield code="c">Jeffrey N. Weiss</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Cham</subfield><subfield code="b">Springer</subfield><subfield code="c">[2023]</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">xiii, 110 Seiten</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1="3" ind2=" "><subfield code="a">Chapter 1. The Nature of the Problem -- Chapter 2. Getting into Medical School -- Chapter 3. Financing Medical School -- Chapter 4. Medical School Curriculum -- Chapter 5. Post Medical School Graduate Training -- Chapter 6. Jobs -- Chapter 7. Electronic Medical Records (EMR) -- Chapter 8. Physician "Burnout" -- Chapter 9. Getting Paid – Medicare/Medicaid/Private Insurance Companies -- Chapter 10. What are the Customer Experience Challenges in Healthcare? -- Chapter 11. Drug Pricing -- Chapter 12. "Malpractice" -- Chapter 13. Hospital Employment -- Chapter14. Private Equity -- Chapter 15. What Country has the Best Healthcare? -- Chapter 16. Health Insurance Portability and Accountability Act (HIPAA) -- Chapter 17. Political Influence -- Chapter 18. Possible Solutions -- Chapter 19. Summary. .</subfield></datafield><datafield tag="520" ind1="3" ind2=" "><subfield code="a">This book is the first volume to individually dissect and explore the reasons physicians are leaving medicine. It lays out potential solutions to many of the problems, which will result in a happier practicing physician. Chapters begin with the nature of the problem, and go through a physician's life cycle on the job, from medical school through post-grad and onwards. Chapters will also cover issues as a practicing physician and how to help alleviate these problems. The book ends with potential solutions to the issue of physician burnout. Physician Burnout: Why Doctors Are Leaving Medicine and How to Fix It is a must-have resource for practicing physicians, healthcare providers, and healthcare management. It is also a great resource for medical school students and those looking to get into the healthcare field. .</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Berufsbild</subfield><subfield code="0">(DE-588)4069340-5</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Arzt</subfield><subfield code="0">(DE-588)4003157-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">Medicine.</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Arzt</subfield><subfield code="0">(DE-588)4003157-3</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Berufsbild</subfield><subfield code="0">(DE-588)4069340-5</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Online-Ausgabe</subfield><subfield code="z">978-3-031-27979-9</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Augsburg - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=034236391&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Augsburg - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=034236391&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Klappentext</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-034236391</subfield></datafield></record></collection> |
| id | DE-604.BV048972804 |
| illustrated | Not Illustrated |
| index_date | 2024-07-03T22:03:13Z |
| indexdate | 2024-07-10T09:51:40Z |
| institution | BVB |
| isbn | 9783031279782 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-034236391 |
| oclc_num | 1385302212 |
| open_access_boolean | |
| owner | DE-384 |
| owner_facet | DE-384 |
| physical | xiii, 110 Seiten |
| publishDate | 2023 |
| publishDateSearch | 2023 |
| publishDateSort | 2023 |
| publisher | Springer |
| record_format | marc |
| spelling | Weiss, Jeffrey N. Verfasser (DE-588)1256039845 aut Physician crisis why physicians are leaving medicine, why you should stay, and how to be happy Jeffrey N. Weiss Cham Springer [2023] xiii, 110 Seiten txt rdacontent n rdamedia nc rdacarrier Chapter 1. The Nature of the Problem -- Chapter 2. Getting into Medical School -- Chapter 3. Financing Medical School -- Chapter 4. Medical School Curriculum -- Chapter 5. Post Medical School Graduate Training -- Chapter 6. Jobs -- Chapter 7. Electronic Medical Records (EMR) -- Chapter 8. Physician "Burnout" -- Chapter 9. Getting Paid – Medicare/Medicaid/Private Insurance Companies -- Chapter 10. What are the Customer Experience Challenges in Healthcare? -- Chapter 11. Drug Pricing -- Chapter 12. "Malpractice" -- Chapter 13. Hospital Employment -- Chapter14. Private Equity -- Chapter 15. What Country has the Best Healthcare? -- Chapter 16. Health Insurance Portability and Accountability Act (HIPAA) -- Chapter 17. Political Influence -- Chapter 18. Possible Solutions -- Chapter 19. Summary. . This book is the first volume to individually dissect and explore the reasons physicians are leaving medicine. It lays out potential solutions to many of the problems, which will result in a happier practicing physician. Chapters begin with the nature of the problem, and go through a physician's life cycle on the job, from medical school through post-grad and onwards. Chapters will also cover issues as a practicing physician and how to help alleviate these problems. The book ends with potential solutions to the issue of physician burnout. Physician Burnout: Why Doctors Are Leaving Medicine and How to Fix It is a must-have resource for practicing physicians, healthcare providers, and healthcare management. It is also a great resource for medical school students and those looking to get into the healthcare field. . Berufsbild (DE-588)4069340-5 gnd rswk-swf Arzt (DE-588)4003157-3 gnd rswk-swf Medicine. Arzt (DE-588)4003157-3 s Berufsbild (DE-588)4069340-5 s DE-604 Erscheint auch als Online-Ausgabe 978-3-031-27979-9 Digitalisierung UB Augsburg - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=034236391&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis Digitalisierung UB Augsburg - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=034236391&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA Klappentext |
| spellingShingle | Weiss, Jeffrey N. Physician crisis why physicians are leaving medicine, why you should stay, and how to be happy Berufsbild (DE-588)4069340-5 gnd Arzt (DE-588)4003157-3 gnd |
| subject_GND | (DE-588)4069340-5 (DE-588)4003157-3 |
| title | Physician crisis why physicians are leaving medicine, why you should stay, and how to be happy |
| title_auth | Physician crisis why physicians are leaving medicine, why you should stay, and how to be happy |
| title_exact_search | Physician crisis why physicians are leaving medicine, why you should stay, and how to be happy |
| title_exact_search_txtP | Physician crisis why physicians are leaving medicine, why you should stay, and how to be happy |
| title_full | Physician crisis why physicians are leaving medicine, why you should stay, and how to be happy Jeffrey N. Weiss |
| title_fullStr | Physician crisis why physicians are leaving medicine, why you should stay, and how to be happy Jeffrey N. Weiss |
| title_full_unstemmed | Physician crisis why physicians are leaving medicine, why you should stay, and how to be happy Jeffrey N. Weiss |
| title_short | Physician crisis |
| title_sort | physician crisis why physicians are leaving medicine why you should stay and how to be happy |
| title_sub | why physicians are leaving medicine, why you should stay, and how to be happy |
| topic | Berufsbild (DE-588)4069340-5 gnd Arzt (DE-588)4003157-3 gnd |
| topic_facet | Berufsbild Arzt |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=034236391&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=034236391&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT weissjeffreyn physiciancrisiswhyphysiciansareleavingmedicinewhyyoushouldstayandhowtobehappy |