Deception in medieval warfare: trickery and cunning in the central Middle Ages
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
Woodbridge
The Boydell Press
[2022]
|
| Schriftenreihe: | Warfare in history
[53] |
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis Klappentext |
| Beschreibung: | Bandzählung der Verlagsseite entnommen |
| Beschreibung: | XIV, 268 Seiten Illustrationen, Karten |
| ISBN: | 9781783276783 |
Internformat
MARC
| LEADER | 00000nam a2200000 cb4500 | ||
|---|---|---|---|
| 001 | BV047457702 | ||
| 003 | DE-604 | ||
| 005 | 20240830 | ||
| 007 | t | ||
| 008 | 210908s2022 a||| m||| 00||| eng d | ||
| 020 | |a 9781783276783 |c hardback |9 978-1-78327-678-3 | ||
| 035 | |a (OCoLC)1312709778 | ||
| 035 | |a (DE-599)BVBBV047457702 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-11 |a DE-12 |a DE-384 |a DE-B220 | ||
| 084 | |a HIST |q DE-12 |2 fid | ||
| 084 | |a NK 7015 |0 (DE-625)126155: |2 rvk | ||
| 084 | |a NM 1300 |0 (DE-625)126290: |2 rvk | ||
| 084 | |a NM 1400 |0 (DE-625)126291: |2 rvk | ||
| 084 | |a NM 6320 |0 (DE-625)126364: |2 rvk | ||
| 100 | 1 | |a Titterton, James |d 1988- |e Verfasser |0 (DE-588)1260558495 |4 aut | |
| 245 | 1 | 0 | |a Deception in medieval warfare |b trickery and cunning in the central Middle Ages |c James Titterton |
| 264 | 1 | |a Woodbridge |b The Boydell Press |c [2022] | |
| 264 | 4 | |c © 2022 | |
| 300 | |a XIV, 268 Seiten |b Illustrationen, Karten | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 1 | |a Warfare in history |v [53] | |
| 500 | |a Bandzählung der Verlagsseite entnommen | ||
| 648 | 7 | |a Geschichte 1000-1320 |2 gnd |9 rswk-swf | |
| 650 | 0 | 7 | |a Täuschung |g Militär |0 (DE-588)4184333-2 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Kriegführung |0 (DE-588)4073817-6 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Kriegslist |0 (DE-588)4294189-1 |2 gnd |9 rswk-swf |
| 651 | 7 | |a Europa |0 (DE-588)4015701-5 |2 gnd |9 rswk-swf | |
| 651 | 7 | |a Kreuzfahrerstaaten |0 (DE-588)4033077-1 |2 gnd |9 rswk-swf | |
| 655 | 7 | |0 (DE-588)4113937-9 |a Hochschulschrift |2 gnd-content | |
| 689 | 0 | 0 | |a Europa |0 (DE-588)4015701-5 |D g |
| 689 | 0 | 1 | |a Kreuzfahrerstaaten |0 (DE-588)4033077-1 |D g |
| 689 | 0 | 2 | |a Kriegslist |0 (DE-588)4294189-1 |D s |
| 689 | 0 | 3 | |a Täuschung |g Militär |0 (DE-588)4184333-2 |D s |
| 689 | 0 | 4 | |a Kriegführung |0 (DE-588)4073817-6 |D s |
| 689 | 0 | 5 | |a Geschichte 1000-1320 |A z |
| 689 | 0 | |5 DE-604 | |
| 830 | 0 | |a Warfare in history |v [53] |w (DE-604)BV010798274 |9 53 | |
| 856 | 4 | 2 | |m Digitalisierung BSB München - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032859542&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 856 | 4 | 2 | |m Digitalisierung UB Augsburg - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032859542&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |3 Klappentext |
| 940 | 1 | |q BSB_NED_20220627 | |
| 942 | 1 | 1 | |c 355.009 |e 22/bsb |f 0902 |g 4 |
| 943 | 1 | |a oai:aleph.bib-bvb.de:BVB01-032859542 | |
Datensatz im Suchindex
| _version_ | 1808860406678028288 |
|---|---|
| adam_text |
Contents List of Illustrations viii Acknowledgements ix List of Abbreviations x Notes on the Text xv Introduction: Low Cunning in the High Middle Ages I x Trickery in Medieval Culture: Source and Problems 9 2 Military Intelligence: Misdirection, Misinformation and Espionage 27 The Element of Surprise:Ambushes and Night Raids 53 3 4 The Feigned Flight 5 72 Disguises 88 6 Bribes and Inducements 123 7 Oaths and Truces 134 8 The Language of Deception 151 9 The Morality of Deception 171 Conclusion 202 Appendix: Taxonomy of Deceptions in Medieval Chronicles c. 1000-1320 207 Bibliography 243 Index 265
eception and trickery are a universal feature of warfare, from D the Trojan horse to the inflatable tanks of the Second World War. The wars of the Central Middle Ages (c. 1000-1320] were no exception. This book looks at the various tricks reported in medieval chronicles, from the Normans feigning flight at the battle of Hastings [1066] to draw the English off Senlac Hill, to the Turks who infiltrated the Frankish camp at the Field of Blood [1119] disguised as bird sellers, to the Scottish camp followers descending on the field of Bannockburn [1314] waving laundry as banners to mimic a division of soldiers. This study also considers what contemporary society thought about deception on the battlefield: was it a legitimate way to fight? Was cunning considered an admirable quality in a warrior? Were the culturally and religious ‘other’ thought to be more deceitful in war than Western Europeans? Through a detailed analysis of vocabulary and narrative devices, this book reveals a society with a profound moral ambivalence towards military deception, in which authors were able to celebrate a warrior’s cunning while simultaneously condemning their enemies for similar acts of deceit. It also includes an appendix cataloguing over four hundred incidents of military deception as recorded in contemporary chronicle narratives. |
| adam_txt |
Contents List of Illustrations viii Acknowledgements ix List of Abbreviations x Notes on the Text xv Introduction: Low Cunning in the High Middle Ages I x Trickery in Medieval Culture: Source and Problems 9 2 Military Intelligence: Misdirection, Misinformation and Espionage 27 The Element of Surprise:Ambushes and Night Raids 53 3 4 The Feigned Flight 5 72 Disguises 88 6 Bribes and Inducements 123 7 Oaths and Truces 134 8 The Language of Deception 151 9 The Morality of Deception 171 Conclusion 202 Appendix: Taxonomy of Deceptions in Medieval Chronicles c. 1000-1320 207 Bibliography 243 Index 265
eception and trickery are a universal feature of warfare, from D the Trojan horse to the inflatable tanks of the Second World War. The wars of the Central Middle Ages (c. 1000-1320] were no exception. This book looks at the various tricks reported in medieval chronicles, from the Normans feigning flight at the battle of Hastings [1066] to draw the English off Senlac Hill, to the Turks who infiltrated the Frankish camp at the Field of Blood [1119] disguised as bird sellers, to the Scottish camp followers descending on the field of Bannockburn [1314] waving laundry as banners to mimic a division of soldiers. This study also considers what contemporary society thought about deception on the battlefield: was it a legitimate way to fight? Was cunning considered an admirable quality in a warrior? Were the culturally and religious ‘other’ thought to be more deceitful in war than Western Europeans? Through a detailed analysis of vocabulary and narrative devices, this book reveals a society with a profound moral ambivalence towards military deception, in which authors were able to celebrate a warrior’s cunning while simultaneously condemning their enemies for similar acts of deceit. It also includes an appendix cataloguing over four hundred incidents of military deception as recorded in contemporary chronicle narratives. |
| any_adam_object | 1 |
| any_adam_object_boolean | 1 |
| author | Titterton, James 1988- |
| author_GND | (DE-588)1260558495 |
| author_facet | Titterton, James 1988- |
| author_role | aut |
| author_sort | Titterton, James 1988- |
| author_variant | j t jt |
| building | Verbundindex |
| bvnumber | BV047457702 |
| classification_rvk | NK 7015 NM 1300 NM 1400 NM 6320 |
| ctrlnum | (OCoLC)1312709778 (DE-599)BVBBV047457702 |
| discipline | Geschichte |
| discipline_str_mv | Geschichte |
| era | Geschichte 1000-1320 gnd |
| era_facet | Geschichte 1000-1320 |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>00000nam a2200000 cb4500</leader><controlfield tag="001">BV047457702</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20240830</controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">210908s2022 a||| m||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781783276783</subfield><subfield code="c">hardback</subfield><subfield code="9">978-1-78327-678-3</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1312709778</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV047457702</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-11</subfield><subfield code="a">DE-12</subfield><subfield code="a">DE-384</subfield><subfield code="a">DE-B220</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">HIST</subfield><subfield code="q">DE-12</subfield><subfield code="2">fid</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">NK 7015</subfield><subfield code="0">(DE-625)126155:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">NM 1300</subfield><subfield code="0">(DE-625)126290:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">NM 1400</subfield><subfield code="0">(DE-625)126291:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">NM 6320</subfield><subfield code="0">(DE-625)126364:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Titterton, James</subfield><subfield code="d">1988-</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1260558495</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Deception in medieval warfare</subfield><subfield code="b">trickery and cunning in the central Middle Ages</subfield><subfield code="c">James Titterton</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Woodbridge</subfield><subfield code="b">The Boydell Press</subfield><subfield code="c">[2022]</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">© 2022</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">XIV, 268 Seiten</subfield><subfield code="b">Illustrationen, Karten</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Warfare in history</subfield><subfield code="v">[53]</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Bandzählung der Verlagsseite entnommen</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte 1000-1320</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Täuschung</subfield><subfield code="g">Militär</subfield><subfield code="0">(DE-588)4184333-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Kriegführung</subfield><subfield code="0">(DE-588)4073817-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Kriegslist</subfield><subfield code="0">(DE-588)4294189-1</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Europa</subfield><subfield code="0">(DE-588)4015701-5</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Kreuzfahrerstaaten</subfield><subfield code="0">(DE-588)4033077-1</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)4113937-9</subfield><subfield code="a">Hochschulschrift</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Europa</subfield><subfield code="0">(DE-588)4015701-5</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Kreuzfahrerstaaten</subfield><subfield code="0">(DE-588)4033077-1</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Kriegslist</subfield><subfield code="0">(DE-588)4294189-1</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Täuschung</subfield><subfield code="g">Militär</subfield><subfield code="0">(DE-588)4184333-2</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="4"><subfield code="a">Kriegführung</subfield><subfield code="0">(DE-588)4073817-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="5"><subfield code="a">Geschichte 1000-1320</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Warfare in history</subfield><subfield code="v">[53]</subfield><subfield code="w">(DE-604)BV010798274</subfield><subfield code="9">53</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032859542&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Augsburg - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032859542&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Klappentext</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">BSB_NED_20220627</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">355.009</subfield><subfield code="e">22/bsb</subfield><subfield code="f">0902</subfield><subfield code="g">4</subfield></datafield><datafield tag="943" ind1="1" ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-032859542</subfield></datafield></record></collection> |
| genre | (DE-588)4113937-9 Hochschulschrift gnd-content |
| genre_facet | Hochschulschrift |
| geographic | Europa (DE-588)4015701-5 gnd Kreuzfahrerstaaten (DE-588)4033077-1 gnd |
| geographic_facet | Europa Kreuzfahrerstaaten |
| id | DE-604.BV047457702 |
| illustrated | Illustrated |
| index_date | 2024-07-03T18:05:14Z |
| indexdate | 2024-08-31T00:21:51Z |
| institution | BVB |
| isbn | 9781783276783 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-032859542 |
| oclc_num | 1312709778 |
| open_access_boolean | |
| owner | DE-11 DE-12 DE-384 DE-B220 |
| owner_facet | DE-11 DE-12 DE-384 DE-B220 |
| physical | XIV, 268 Seiten Illustrationen, Karten |
| psigel | BSB_NED_20220627 |
| publishDate | 2022 |
| publishDateSearch | 2022 |
| publishDateSort | 2022 |
| publisher | The Boydell Press |
| record_format | marc |
| series | Warfare in history |
| series2 | Warfare in history |
| spelling | Titterton, James 1988- Verfasser (DE-588)1260558495 aut Deception in medieval warfare trickery and cunning in the central Middle Ages James Titterton Woodbridge The Boydell Press [2022] © 2022 XIV, 268 Seiten Illustrationen, Karten txt rdacontent n rdamedia nc rdacarrier Warfare in history [53] Bandzählung der Verlagsseite entnommen Geschichte 1000-1320 gnd rswk-swf Täuschung Militär (DE-588)4184333-2 gnd rswk-swf Kriegführung (DE-588)4073817-6 gnd rswk-swf Kriegslist (DE-588)4294189-1 gnd rswk-swf Europa (DE-588)4015701-5 gnd rswk-swf Kreuzfahrerstaaten (DE-588)4033077-1 gnd rswk-swf (DE-588)4113937-9 Hochschulschrift gnd-content Europa (DE-588)4015701-5 g Kreuzfahrerstaaten (DE-588)4033077-1 g Kriegslist (DE-588)4294189-1 s Täuschung Militär (DE-588)4184333-2 s Kriegführung (DE-588)4073817-6 s Geschichte 1000-1320 z DE-604 Warfare in history [53] (DE-604)BV010798274 53 Digitalisierung BSB München - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032859542&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis Digitalisierung UB Augsburg - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032859542&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA Klappentext |
| spellingShingle | Titterton, James 1988- Deception in medieval warfare trickery and cunning in the central Middle Ages Täuschung Militär (DE-588)4184333-2 gnd Kriegführung (DE-588)4073817-6 gnd Kriegslist (DE-588)4294189-1 gnd Warfare in history |
| subject_GND | (DE-588)4184333-2 (DE-588)4073817-6 (DE-588)4294189-1 (DE-588)4015701-5 (DE-588)4033077-1 (DE-588)4113937-9 |
| title | Deception in medieval warfare trickery and cunning in the central Middle Ages |
| title_auth | Deception in medieval warfare trickery and cunning in the central Middle Ages |
| title_exact_search | Deception in medieval warfare trickery and cunning in the central Middle Ages |
| title_exact_search_txtP | Deception in medieval warfare trickery and cunning in the central Middle Ages |
| title_full | Deception in medieval warfare trickery and cunning in the central Middle Ages James Titterton |
| title_fullStr | Deception in medieval warfare trickery and cunning in the central Middle Ages James Titterton |
| title_full_unstemmed | Deception in medieval warfare trickery and cunning in the central Middle Ages James Titterton |
| title_short | Deception in medieval warfare |
| title_sort | deception in medieval warfare trickery and cunning in the central middle ages |
| title_sub | trickery and cunning in the central Middle Ages |
| topic | Täuschung Militär (DE-588)4184333-2 gnd Kriegführung (DE-588)4073817-6 gnd Kriegslist (DE-588)4294189-1 gnd |
| topic_facet | Täuschung Militär Kriegführung Kriegslist Europa Kreuzfahrerstaaten Hochschulschrift |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032859542&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032859542&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |
| volume_link | (DE-604)BV010798274 |
| work_keys_str_mv | AT tittertonjames deceptioninmedievalwarfaretrickeryandcunninginthecentralmiddleages |