Lail al-maḥw nahār aḏ-ḏākira: šahādāt wa-maqālāt = The night of erasure, the daylight of remembring
ليل المهو، نهار الذاكرة شهادات ومقالات
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | Arabic |
| Veröffentlicht: |
Bairūt
ad-Dār al-ʿArabīya li-l-ʿUlūm Nāširūn
2021 m - 1442 h
|
| Ausgabe: | aṭ-Ṭabʿa al-ūlā |
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | 246 Seiten 22 cm |
| ISBN: | 9786140132498 |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV047354913 | ||
| 003 | DE-604 | ||
| 005 | 20240223 | ||
| 007 | t | ||
| 008 | 210702s2021 le |||| 00||| ara d | ||
| 020 | |a 9786140132498 |9 9786140132498 | ||
| 035 | |a (OCoLC)1289761118 | ||
| 035 | |a (DE-599)BVBBV047354913 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a ara | |
| 044 | |a le |c LB | ||
| 049 | |a DE-12 |a DE-473 | ||
| 084 | |a EN 3599 |0 (DE-625)25468: |2 rvk | ||
| 100 | 1 | |6 880-01 |a Naṣrallāh, Ibrāhīm |d 1954- |0 (DE-588)136370349 |4 aut | |
| 245 | 1 | 0 | |6 880-03 |a Lail al-maḥw nahār aḏ-ḏākira |b šahādāt wa-maqālāt = The night of erasure, the daylight of remembring |c Ibrāhīm Naṣrallāh |
| 246 | 1 | |a Layl al-maḥw nahār al-dhākirah : shahādāt wa-maqālāt | |
| 246 | 1 | 1 | |a The night of erasure, the daylight of remembring |
| 250 | |6 880-02 |a aṭ-Ṭabʿa al-ūlā | ||
| 264 | 1 | |6 880-04 |a Bairūt |b ad-Dār al-ʿArabīya li-l-ʿUlūm Nāširūn |c 2021 m - 1442 h | |
| 300 | |a 246 Seiten |c 22 cm | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 546 | |a Text arabisch | ||
| 546 | |b Arabische Schrift | ||
| 655 | 7 | |0 (DE-588)1071854844 |a Fiktionale Darstellung |2 gnd-content | |
| 856 | 4 | 2 | |m Digitalisierung UB Bamberg - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032757042&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 880 | 1 | |6 100-01/(3/r |a نصر الله, إبراهيم |4 aut | |
| 880 | |6 250-02/(3/r |a الطبعة الأولى | ||
| 880 | 1 | 0 | |6 245-03/(3/r |a ليل المهو، نهار الذاكرة |b شهادات ومقالات |c إبراهيم نصر الله |
| 880 | 1 | |6 264-04/(3/r |a بيروت |b الدار العربية للعلوم ناشرون |c 2021 | |
| 940 | 1 | |f ara | |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-032757042 | ||
Datensatz im Suchindex
| _version_ | 1804182581507260416 |
|---|---|
| adam_txt |
£· ? .ь •Г’ с С. |
| any_adam_object | 1 |
| any_adam_object_boolean | 1 |
| author | Naṣrallāh, Ibrāhīm 1954- |
| author_GND | (DE-588)136370349 |
| author_facet | Naṣrallāh, Ibrāhīm 1954- |
| author_role | aut |
| author_sort | Naṣrallāh, Ibrāhīm 1954- |
| author_variant | i n in |
| building | Verbundindex |
| bvnumber | BV047354913 |
| classification_rvk | EN 3599 |
| ctrlnum | (OCoLC)1289761118 (DE-599)BVBBV047354913 |
| discipline | Außereuropäische Sprachen und Literaturen Literaturwissenschaft |
| discipline_str_mv | Außereuropäische Sprachen und Literaturen Literaturwissenschaft |
| edition | aṭ-Ṭabʿa al-ūlā |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01936nam a2200421 c 4500</leader><controlfield tag="001">BV047354913</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20240223 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">210702s2021 le |||| 00||| ara d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9786140132498</subfield><subfield code="9">9786140132498</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1289761118</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV047354913</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">ara</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">le</subfield><subfield code="c">LB</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield><subfield code="a">DE-473</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">EN 3599</subfield><subfield code="0">(DE-625)25468:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="6">880-01</subfield><subfield code="a">Naṣrallāh, Ibrāhīm</subfield><subfield code="d">1954-</subfield><subfield code="0">(DE-588)136370349</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="6">880-03</subfield><subfield code="a">Lail al-maḥw nahār aḏ-ḏākira</subfield><subfield code="b">šahādāt wa-maqālāt = The night of erasure, the daylight of remembring</subfield><subfield code="c">Ibrāhīm Naṣrallāh</subfield></datafield><datafield tag="246" ind1="1" ind2=" "><subfield code="a">Layl al-maḥw nahār al-dhākirah : shahādāt wa-maqālāt</subfield></datafield><datafield tag="246" ind1="1" ind2="1"><subfield code="a">The night of erasure, the daylight of remembring</subfield></datafield><datafield tag="250" ind1=" " ind2=" "><subfield code="6">880-02</subfield><subfield code="a">aṭ-Ṭabʿa al-ūlā</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="6">880-04</subfield><subfield code="a">Bairūt</subfield><subfield code="b">ad-Dār al-ʿArabīya li-l-ʿUlūm Nāširūn</subfield><subfield code="c">2021 m - 1442 h</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">246 Seiten</subfield><subfield code="c">22 cm</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="546" ind1=" " ind2=" "><subfield code="a">Text arabisch</subfield></datafield><datafield tag="546" ind1=" " ind2=" "><subfield code="b">Arabische Schrift</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)1071854844</subfield><subfield code="a">Fiktionale Darstellung</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Bamberg - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032757042&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="880" ind1="1" ind2=" "><subfield code="6">100-01/(3/r</subfield><subfield code="a">نصر الله, إبراهيم</subfield><subfield code="4">aut</subfield></datafield><datafield tag="880" ind1=" " ind2=" "><subfield code="6">250-02/(3/r</subfield><subfield code="a">الطبعة الأولى</subfield></datafield><datafield tag="880" ind1="1" ind2="0"><subfield code="6">245-03/(3/r</subfield><subfield code="a">ليل المهو، نهار الذاكرة</subfield><subfield code="b">شهادات ومقالات</subfield><subfield code="c">إبراهيم نصر الله</subfield></datafield><datafield tag="880" ind1=" " ind2="1"><subfield code="6">264-04/(3/r</subfield><subfield code="a">بيروت</subfield><subfield code="b">الدار العربية للعلوم ناشرون</subfield><subfield code="c">2021</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="f">ara</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-032757042</subfield></datafield></record></collection> |
| genre | (DE-588)1071854844 Fiktionale Darstellung gnd-content |
| genre_facet | Fiktionale Darstellung |
| id | DE-604.BV047354913 |
| illustrated | Not Illustrated |
| index_date | 2024-07-03T17:39:21Z |
| indexdate | 2024-07-10T09:09:50Z |
| institution | BVB |
| isbn | 9786140132498 |
| language | Arabic |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-032757042 |
| oclc_num | 1289761118 |
| open_access_boolean | |
| owner | DE-12 DE-473 DE-BY-UBG |
| owner_facet | DE-12 DE-473 DE-BY-UBG |
| physical | 246 Seiten 22 cm |
| publishDate | 2021 |
| publishDateSearch | 2021 |
| publishDateSort | 2021 |
| publisher | ad-Dār al-ʿArabīya li-l-ʿUlūm Nāširūn |
| record_format | marc |
| spelling | 880-01 Naṣrallāh, Ibrāhīm 1954- (DE-588)136370349 aut 880-03 Lail al-maḥw nahār aḏ-ḏākira šahādāt wa-maqālāt = The night of erasure, the daylight of remembring Ibrāhīm Naṣrallāh Layl al-maḥw nahār al-dhākirah : shahādāt wa-maqālāt The night of erasure, the daylight of remembring 880-02 aṭ-Ṭabʿa al-ūlā 880-04 Bairūt ad-Dār al-ʿArabīya li-l-ʿUlūm Nāširūn 2021 m - 1442 h 246 Seiten 22 cm txt rdacontent n rdamedia nc rdacarrier Text arabisch Arabische Schrift (DE-588)1071854844 Fiktionale Darstellung gnd-content Digitalisierung UB Bamberg - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032757042&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis 100-01/(3/r نصر الله, إبراهيم aut 250-02/(3/r الطبعة الأولى 245-03/(3/r ليل المهو، نهار الذاكرة شهادات ومقالات إبراهيم نصر الله 264-04/(3/r بيروت الدار العربية للعلوم ناشرون 2021 |
| spellingShingle | Naṣrallāh, Ibrāhīm 1954- Lail al-maḥw nahār aḏ-ḏākira šahādāt wa-maqālāt = The night of erasure, the daylight of remembring |
| subject_GND | (DE-588)1071854844 |
| title | Lail al-maḥw nahār aḏ-ḏākira šahādāt wa-maqālāt = The night of erasure, the daylight of remembring |
| title_alt | Layl al-maḥw nahār al-dhākirah : shahādāt wa-maqālāt The night of erasure, the daylight of remembring |
| title_auth | Lail al-maḥw nahār aḏ-ḏākira šahādāt wa-maqālāt = The night of erasure, the daylight of remembring |
| title_exact_search | Lail al-maḥw nahār aḏ-ḏākira šahādāt wa-maqālāt = The night of erasure, the daylight of remembring |
| title_exact_search_txtP | Lail al-maḥw nahār aḏ-ḏākira šahādāt wa-maqālāt = The night of erasure, the daylight of remembring |
| title_full | Lail al-maḥw nahār aḏ-ḏākira šahādāt wa-maqālāt = The night of erasure, the daylight of remembring Ibrāhīm Naṣrallāh |
| title_fullStr | Lail al-maḥw nahār aḏ-ḏākira šahādāt wa-maqālāt = The night of erasure, the daylight of remembring Ibrāhīm Naṣrallāh |
| title_full_unstemmed | Lail al-maḥw nahār aḏ-ḏākira šahādāt wa-maqālāt = The night of erasure, the daylight of remembring Ibrāhīm Naṣrallāh |
| title_short | Lail al-maḥw nahār aḏ-ḏākira |
| title_sort | lail al mahw nahar ad dakira sahadat wa maqalat the night of erasure the daylight of remembring |
| title_sub | šahādāt wa-maqālāt = The night of erasure, the daylight of remembring |
| topic_facet | Fiktionale Darstellung |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032757042&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT nasrallahibrahim lailalmahwnaharaddakirasahadatwamaqalatthenightoferasurethedaylightofremembring AT nasrallahibrahim laylalmahwnaharaldhakirahshahadatwamaqalat AT nasrallahibrahim thenightoferasurethedaylightofremembring |