The tombs of Ptahemwia and Sethnakht at Saqqara:
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Weitere Verfasser: | , , , , , , , |
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
Leiden
Sidestone Press
[2020]
|
| Schriftenreihe: | Papers on archaeology of the Leiden Museum of Antiquities
22 |
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | 427 Seiten Illustrationen, Pläne |
| ISBN: | 9789088908101 9789088908095 |
Internformat
MARC
| LEADER | 00000nam a2200000 cb4500 | ||
|---|---|---|---|
| 001 | BV046937688 | ||
| 003 | DE-604 | ||
| 005 | 20210804 | ||
| 007 | t | ||
| 008 | 201013s2020 a||| |||| 00||| eng d | ||
| 020 | |a 9789088908101 |c Hardcover |9 978-90-8890-810-1 | ||
| 020 | |a 9789088908095 |c Softcover |9 978-90-8890-809-5 | ||
| 035 | |a (OCoLC)1237586110 | ||
| 035 | |a (DE-599)BVBBV046937688 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-11 |a DE-12 |a DE-19 |a DE-20 |a DE-188 | ||
| 084 | |a ALT |q DE-12 |2 fid | ||
| 084 | |a LE 5244 |0 (DE-625)91004: |2 rvk | ||
| 100 | 1 | |a Raven, Maarten J. |d 1953- |e Verfasser |0 (DE-588)172326273 |4 aut | |
| 245 | 1 | 0 | |a The tombs of Ptahemwia and Sethnakht at Saqqara |c Maarten J. Raven ; with contributions by Harold M. Hays, Barbara G. Aston, W. Paul van Pelt, Nico T.B. Staring, and Ladislava Horáčková ; plans by Willem F.M. Beex and Annelies Bleeker ; drawings by Dorothea Schulz, William Schenck and Lyla Pinch Brock and photographs by Peter Jan Bomhof and Anneke J. de Kemp |
| 264 | 1 | |a Leiden |b Sidestone Press |c [2020] | |
| 300 | |a 427 Seiten |b Illustrationen, Pläne | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 1 | |a Papers on archaeology of the Leiden Museum of Antiquities |v 22 | |
| 650 | 0 | 7 | |a Funde |0 (DE-588)4071507-3 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Ausgrabung |0 (DE-588)4129464-6 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Grab |0 (DE-588)4021716-4 |2 gnd |9 rswk-swf |
| 651 | 7 | |a Sakkara |0 (DE-588)4051338-5 |2 gnd |9 rswk-swf | |
| 688 | 7 | |a Saqqara |0 (DE-2581)TH000008615 |2 gbd | |
| 688 | 7 | |a Ausgrabungen |0 (DE-2581)TH000008164 |2 gbd | |
| 689 | 0 | 0 | |a Sakkara |0 (DE-588)4051338-5 |D g |
| 689 | 0 | 1 | |a Grab |0 (DE-588)4021716-4 |D s |
| 689 | 0 | 2 | |a Ausgrabung |0 (DE-588)4129464-6 |D s |
| 689 | 0 | 3 | |a Funde |0 (DE-588)4071507-3 |D s |
| 689 | 0 | |5 DE-604 | |
| 700 | 1 | |a Hays, Harold M. |0 (DE-588)1023747545 |4 ctb | |
| 700 | 1 | |a Aston, Barbara G. |4 ctb | |
| 700 | 1 | |a Pelt, W. Paul van |0 (DE-588)1052831753 |4 ctb | |
| 700 | 1 | |a Staring, Nico |0 (DE-588)1195645260 |4 ctb | |
| 700 | 1 | |a Horáčková, Ladislava |d 1949- |0 (DE-588)1226809561 |4 ctb | |
| 700 | 1 | |a Beex, Willem F.M. |4 oth | |
| 700 | 1 | |a Bleeker, Annelies |4 oth | |
| 700 | 1 | |a Schulz, Dorothea |d 1962- |0 (DE-588)119239299 |4 ill | |
| 700 | 1 | |a Schenck, William |4 ill | |
| 700 | 1 | |a Pinch Brock, Lyla |4 ill | |
| 700 | 1 | |a Bomhof, Peter Jan |4 oth | |
| 700 | 1 | |a Kemp, Anneke J de |4 oth | |
| 776 | 0 | 8 | |i Erscheint auch als |n Online-Ausgabe, PDF |z 978-90-8890-811-8 |
| 830 | 0 | |a Papers on archaeology of the Leiden Museum of Antiquities |v 22 |w (DE-604)BV019589186 |9 22 | |
| 856 | 4 | 2 | |m Digitalisierung BSB München - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032346470&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 940 | 1 | |n gbd | |
| 940 | 1 | |q BSB_NED_20210302 | |
| 940 | 1 | |q gbd_4_2106 | |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-032346470 | ||
| 942 | 1 | 1 | |c 930.1 |e 22/bsb |f 09013 |g 32 |
Datensatz im Suchindex
| _version_ | 1804181837586628608 |
|---|---|
| adam_text | Contents Preface 9 Staff of the expedition, 2007-2010, 2013, 2015-2017 11 I. The site and its history 13 Maarten J. Raven 1. The excavations 13 2. History of the site 18 3. Restoration 23 II. The family and career of Ptahemwia and Sethnakht 27 Maarten J. Raven 1. Ptahemwia 27 2. Sethnakht 34 III. The architecture 37 Maarten J. Raven 1. Introduction 37 2. General remarks on the tomb of Ptahemwia 38 3. The superstructure of Ptahemwia s tomb 42 4. The substructure of Ptahemwia s tomb 49 5. The tomb of Sethnakht 53 6. Adjacent structures 61 7. The survey 68 IV. The reliefs and inscriptions 71 Maarten J. Raven and Harold M. Haysf 1. Introduction 71 2. The courtyard of Ptahemwia [1 -16] 72 3. The central chapel of Ptahemwia [17-27] 99 4. Ptahemwia blocks and fragments of unknown location [28-59] 108 5. Blocks and fragments not belonging to the tomb [60-153] 113 6. Iconography and style (M.J. Raven) 136
V. The graffiti 145 W. Paul van Pelt and Nico Staring 1. Introduction 145 2. Graffiti types 146 3. Catalogue 147 VI. Objects 163 Maarten J. Raven 1. Introduction 163 2. Old Kingdom (Cat. 1) 167 3. New Kingdom and Third Intermediate Period (Cat. 2-129) 167 4. Late Period (Cat. 130-198) 200 5. Coptic Period (Cat. 199-285) 212 6. Islamic Period (Cat. 286-291) 234 7. Date unknown (Cat. 292-302) 236 VII. The pottery 239 Barbara G. Aston 1. Introduction 239 2. Fabrics 240 3. Shape terms 248 4. Ptahemwia substructure 250 5. Rim of Ptahemwia shaft 266 6. Ptahemwia chapels 268 7. Ptahemwia courtyard floor 280 8. Sethnakht substructure 282 9. Sethnakht courtyard and chapels 291 10. Feature 2010/3 300 11. Chapel 2007/10 303 12. Shaft 2007/6 308 13. Surface debris 310 14. Corrections to The tomb of Iniuia 321 VIII. Human skeletal remains 323 Ladislava Horáčková 1. Introduction 323 2. Material and methods 324 3. The tomb of Ptahemwia, north chapel 325 4. The tomb of Ptahemwia, central chapel 342 5. The tomb of Ptahemwia, south chapel 347 6. The tomb of Ptahemwia, Chamber F 368 7. Burial 2003/13 370 8. Coptic burials 374 9. The tomb of Sethnakht 387 10. Paleopathology 392 11. General conclusion 397
Concordance of excavation numbers andcatalogue numbers 399 1. Sculpture, reliefs, and Inscriptions (Chapter IV) 399 2. Objects (Chapter VI) 400 3. Pottery (Chapter VII) 402 Spatial distribution of reliefs and objects 405 List of designated features 407 Abbreviations 411 Bibliography 413 Indices 423
|
| adam_txt |
Contents Preface 9 Staff of the expedition, 2007-2010, 2013, 2015-2017 11 I. The site and its history 13 Maarten J. Raven 1. The excavations 13 2. History of the site 18 3. Restoration 23 II. The family and career of Ptahemwia and Sethnakht 27 Maarten J. Raven 1. Ptahemwia 27 2. Sethnakht 34 III. The architecture 37 Maarten J. Raven 1. Introduction 37 2. General remarks on the tomb of Ptahemwia 38 3. The superstructure of Ptahemwia's tomb 42 4. The substructure of Ptahemwia's tomb 49 5. The tomb of Sethnakht 53 6. Adjacent structures 61 7. The survey 68 IV. The reliefs and inscriptions 71 Maarten J. Raven and Harold M. Haysf 1. Introduction 71 2. The courtyard of Ptahemwia [1 -16] 72 3. The central chapel of Ptahemwia [17-27] 99 4. Ptahemwia blocks and fragments of unknown location [28-59] 108 5. Blocks and fragments not belonging to the tomb [60-153] 113 6. Iconography and style (M.J. Raven) 136
V. The graffiti 145 W. Paul van Pelt and Nico Staring 1. Introduction 145 2. Graffiti types 146 3. Catalogue 147 VI. Objects 163 Maarten J. Raven 1. Introduction 163 2. Old Kingdom (Cat. 1) 167 3. New Kingdom and Third Intermediate Period (Cat. 2-129) 167 4. Late Period (Cat. 130-198) 200 5. Coptic Period (Cat. 199-285) 212 6. Islamic Period (Cat. 286-291) 234 7. Date unknown (Cat. 292-302) 236 VII. The pottery 239 Barbara G. Aston 1. Introduction 239 2. Fabrics 240 3. Shape terms 248 4. Ptahemwia substructure 250 5. Rim of Ptahemwia shaft 266 6. Ptahemwia chapels 268 7. Ptahemwia courtyard floor 280 8. Sethnakht substructure 282 9. Sethnakht courtyard and chapels 291 10. Feature 2010/3 300 11. Chapel 2007/10 303 12. Shaft 2007/6 308 13. Surface debris 310 14. Corrections to 'The tomb of Iniuia' 321 VIII. Human skeletal remains 323 Ladislava Horáčková 1. Introduction 323 2. Material and methods 324 3. The tomb of Ptahemwia, north chapel 325 4. The tomb of Ptahemwia, central chapel 342 5. The tomb of Ptahemwia, south chapel 347 6. The tomb of Ptahemwia, Chamber F 368 7. Burial 2003/13 370 8. Coptic burials 374 9. The tomb of Sethnakht 387 10. Paleopathology 392 11. General conclusion 397
Concordance of excavation numbers andcatalogue numbers 399 1. Sculpture, reliefs, and Inscriptions (Chapter IV) 399 2. Objects (Chapter VI) 400 3. Pottery (Chapter VII) 402 Spatial distribution of reliefs and objects 405 List of designated features 407 Abbreviations 411 Bibliography 413 Indices 423 |
| any_adam_object | 1 |
| any_adam_object_boolean | 1 |
| author | Raven, Maarten J. 1953- |
| author2 | Hays, Harold M. Aston, Barbara G. Pelt, W. Paul van Staring, Nico Horáčková, Ladislava 1949- Schulz, Dorothea 1962- Schenck, William Pinch Brock, Lyla |
| author2_role | ctb ctb ctb ctb ctb ill ill ill |
| author2_variant | h m h hm hmh b g a bg bga w p v p wpv wpvp n s ns l h lh d s ds w s ws b l p bl blp |
| author_GND | (DE-588)172326273 (DE-588)1023747545 (DE-588)1052831753 (DE-588)1195645260 (DE-588)1226809561 (DE-588)119239299 |
| author_facet | Raven, Maarten J. 1953- Hays, Harold M. Aston, Barbara G. Pelt, W. Paul van Staring, Nico Horáčková, Ladislava 1949- Schulz, Dorothea 1962- Schenck, William Pinch Brock, Lyla |
| author_role | aut |
| author_sort | Raven, Maarten J. 1953- |
| author_variant | m j r mj mjr |
| building | Verbundindex |
| bvnumber | BV046937688 |
| classification_rvk | LE 5244 |
| ctrlnum | (OCoLC)1237586110 (DE-599)BVBBV046937688 |
| discipline | Klassische Archäologie |
| discipline_str_mv | Klassische Archäologie |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>03022nam a2200661 cb4500</leader><controlfield tag="001">BV046937688</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20210804 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">201013s2020 a||| |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9789088908101</subfield><subfield code="c">Hardcover</subfield><subfield code="9">978-90-8890-810-1</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9789088908095</subfield><subfield code="c">Softcover</subfield><subfield code="9">978-90-8890-809-5</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1237586110</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV046937688</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-11</subfield><subfield code="a">DE-12</subfield><subfield code="a">DE-19</subfield><subfield code="a">DE-20</subfield><subfield code="a">DE-188</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">ALT</subfield><subfield code="q">DE-12</subfield><subfield code="2">fid</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">LE 5244</subfield><subfield code="0">(DE-625)91004:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Raven, Maarten J.</subfield><subfield code="d">1953-</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)172326273</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">The tombs of Ptahemwia and Sethnakht at Saqqara</subfield><subfield code="c">Maarten J. Raven ; with contributions by Harold M. Hays, Barbara G. Aston, W. Paul van Pelt, Nico T.B. Staring, and Ladislava Horáčková ; plans by Willem F.M. Beex and Annelies Bleeker ; drawings by Dorothea Schulz, William Schenck and Lyla Pinch Brock and photographs by Peter Jan Bomhof and Anneke J. de Kemp</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Leiden</subfield><subfield code="b">Sidestone Press</subfield><subfield code="c">[2020]</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">427 Seiten</subfield><subfield code="b">Illustrationen, Pläne</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Papers on archaeology of the Leiden Museum of Antiquities</subfield><subfield code="v">22</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Funde</subfield><subfield code="0">(DE-588)4071507-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Ausgrabung</subfield><subfield code="0">(DE-588)4129464-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Grab</subfield><subfield code="0">(DE-588)4021716-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Sakkara</subfield><subfield code="0">(DE-588)4051338-5</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="688" ind1=" " ind2="7"><subfield code="a">Saqqara</subfield><subfield code="0">(DE-2581)TH000008615</subfield><subfield code="2">gbd</subfield></datafield><datafield tag="688" ind1=" " ind2="7"><subfield code="a">Ausgrabungen</subfield><subfield code="0">(DE-2581)TH000008164</subfield><subfield code="2">gbd</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Sakkara</subfield><subfield code="0">(DE-588)4051338-5</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Grab</subfield><subfield code="0">(DE-588)4021716-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Ausgrabung</subfield><subfield code="0">(DE-588)4129464-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Funde</subfield><subfield code="0">(DE-588)4071507-3</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Hays, Harold M.</subfield><subfield code="0">(DE-588)1023747545</subfield><subfield code="4">ctb</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Aston, Barbara G.</subfield><subfield code="4">ctb</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Pelt, W. Paul van</subfield><subfield code="0">(DE-588)1052831753</subfield><subfield code="4">ctb</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Staring, Nico</subfield><subfield code="0">(DE-588)1195645260</subfield><subfield code="4">ctb</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Horáčková, Ladislava</subfield><subfield code="d">1949-</subfield><subfield code="0">(DE-588)1226809561</subfield><subfield code="4">ctb</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Beex, Willem F.M.</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Bleeker, Annelies</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Schulz, Dorothea</subfield><subfield code="d">1962-</subfield><subfield code="0">(DE-588)119239299</subfield><subfield code="4">ill</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Schenck, William</subfield><subfield code="4">ill</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Pinch Brock, Lyla</subfield><subfield code="4">ill</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Bomhof, Peter Jan</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Kemp, Anneke J de</subfield><subfield code="4">oth</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Online-Ausgabe, PDF</subfield><subfield code="z">978-90-8890-811-8</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Papers on archaeology of the Leiden Museum of Antiquities</subfield><subfield code="v">22</subfield><subfield code="w">(DE-604)BV019589186</subfield><subfield code="9">22</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032346470&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">gbd</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">BSB_NED_20210302</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">gbd_4_2106</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-032346470</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">930.1</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09013</subfield><subfield code="g">32</subfield></datafield></record></collection> |
| geographic | Sakkara (DE-588)4051338-5 gnd |
| geographic_facet | Sakkara |
| id | DE-604.BV046937688 |
| illustrated | Illustrated |
| index_date | 2024-07-03T15:36:53Z |
| indexdate | 2024-07-10T08:58:00Z |
| institution | BVB |
| isbn | 9789088908101 9789088908095 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-032346470 |
| oclc_num | 1237586110 |
| open_access_boolean | |
| owner | DE-11 DE-12 DE-19 DE-BY-UBM DE-20 DE-188 |
| owner_facet | DE-11 DE-12 DE-19 DE-BY-UBM DE-20 DE-188 |
| physical | 427 Seiten Illustrationen, Pläne |
| psigel | BSB_NED_20210302 gbd_4_2106 |
| publishDate | 2020 |
| publishDateSearch | 2020 |
| publishDateSort | 2020 |
| publisher | Sidestone Press |
| record_format | marc |
| series | Papers on archaeology of the Leiden Museum of Antiquities |
| series2 | Papers on archaeology of the Leiden Museum of Antiquities |
| spelling | Raven, Maarten J. 1953- Verfasser (DE-588)172326273 aut The tombs of Ptahemwia and Sethnakht at Saqqara Maarten J. Raven ; with contributions by Harold M. Hays, Barbara G. Aston, W. Paul van Pelt, Nico T.B. Staring, and Ladislava Horáčková ; plans by Willem F.M. Beex and Annelies Bleeker ; drawings by Dorothea Schulz, William Schenck and Lyla Pinch Brock and photographs by Peter Jan Bomhof and Anneke J. de Kemp Leiden Sidestone Press [2020] 427 Seiten Illustrationen, Pläne txt rdacontent n rdamedia nc rdacarrier Papers on archaeology of the Leiden Museum of Antiquities 22 Funde (DE-588)4071507-3 gnd rswk-swf Ausgrabung (DE-588)4129464-6 gnd rswk-swf Grab (DE-588)4021716-4 gnd rswk-swf Sakkara (DE-588)4051338-5 gnd rswk-swf Saqqara (DE-2581)TH000008615 gbd Ausgrabungen (DE-2581)TH000008164 gbd Sakkara (DE-588)4051338-5 g Grab (DE-588)4021716-4 s Ausgrabung (DE-588)4129464-6 s Funde (DE-588)4071507-3 s DE-604 Hays, Harold M. (DE-588)1023747545 ctb Aston, Barbara G. ctb Pelt, W. Paul van (DE-588)1052831753 ctb Staring, Nico (DE-588)1195645260 ctb Horáčková, Ladislava 1949- (DE-588)1226809561 ctb Beex, Willem F.M. oth Bleeker, Annelies oth Schulz, Dorothea 1962- (DE-588)119239299 ill Schenck, William ill Pinch Brock, Lyla ill Bomhof, Peter Jan oth Kemp, Anneke J de oth Erscheint auch als Online-Ausgabe, PDF 978-90-8890-811-8 Papers on archaeology of the Leiden Museum of Antiquities 22 (DE-604)BV019589186 22 Digitalisierung BSB München - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032346470&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Raven, Maarten J. 1953- The tombs of Ptahemwia and Sethnakht at Saqqara Papers on archaeology of the Leiden Museum of Antiquities Funde (DE-588)4071507-3 gnd Ausgrabung (DE-588)4129464-6 gnd Grab (DE-588)4021716-4 gnd |
| subject_GND | (DE-588)4071507-3 (DE-588)4129464-6 (DE-588)4021716-4 (DE-588)4051338-5 |
| title | The tombs of Ptahemwia and Sethnakht at Saqqara |
| title_auth | The tombs of Ptahemwia and Sethnakht at Saqqara |
| title_exact_search | The tombs of Ptahemwia and Sethnakht at Saqqara |
| title_exact_search_txtP | The tombs of Ptahemwia and Sethnakht at Saqqara |
| title_full | The tombs of Ptahemwia and Sethnakht at Saqqara Maarten J. Raven ; with contributions by Harold M. Hays, Barbara G. Aston, W. Paul van Pelt, Nico T.B. Staring, and Ladislava Horáčková ; plans by Willem F.M. Beex and Annelies Bleeker ; drawings by Dorothea Schulz, William Schenck and Lyla Pinch Brock and photographs by Peter Jan Bomhof and Anneke J. de Kemp |
| title_fullStr | The tombs of Ptahemwia and Sethnakht at Saqqara Maarten J. Raven ; with contributions by Harold M. Hays, Barbara G. Aston, W. Paul van Pelt, Nico T.B. Staring, and Ladislava Horáčková ; plans by Willem F.M. Beex and Annelies Bleeker ; drawings by Dorothea Schulz, William Schenck and Lyla Pinch Brock and photographs by Peter Jan Bomhof and Anneke J. de Kemp |
| title_full_unstemmed | The tombs of Ptahemwia and Sethnakht at Saqqara Maarten J. Raven ; with contributions by Harold M. Hays, Barbara G. Aston, W. Paul van Pelt, Nico T.B. Staring, and Ladislava Horáčková ; plans by Willem F.M. Beex and Annelies Bleeker ; drawings by Dorothea Schulz, William Schenck and Lyla Pinch Brock and photographs by Peter Jan Bomhof and Anneke J. de Kemp |
| title_short | The tombs of Ptahemwia and Sethnakht at Saqqara |
| title_sort | the tombs of ptahemwia and sethnakht at saqqara |
| topic | Funde (DE-588)4071507-3 gnd Ausgrabung (DE-588)4129464-6 gnd Grab (DE-588)4021716-4 gnd |
| topic_facet | Funde Ausgrabung Grab Sakkara |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=032346470&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| volume_link | (DE-604)BV019589186 |
| work_keys_str_mv | AT ravenmaartenj thetombsofptahemwiaandsethnakhtatsaqqara AT haysharoldm thetombsofptahemwiaandsethnakhtatsaqqara AT astonbarbarag thetombsofptahemwiaandsethnakhtatsaqqara AT peltwpaulvan thetombsofptahemwiaandsethnakhtatsaqqara AT staringnico thetombsofptahemwiaandsethnakhtatsaqqara AT horackovaladislava thetombsofptahemwiaandsethnakhtatsaqqara AT beexwillemfm thetombsofptahemwiaandsethnakhtatsaqqara AT bleekerannelies thetombsofptahemwiaandsethnakhtatsaqqara AT schulzdorothea thetombsofptahemwiaandsethnakhtatsaqqara AT schenckwilliam thetombsofptahemwiaandsethnakhtatsaqqara AT pinchbrocklyla thetombsofptahemwiaandsethnakhtatsaqqara AT bomhofpeterjan thetombsofptahemwiaandsethnakhtatsaqqara AT kempannekejde thetombsofptahemwiaandsethnakhtatsaqqara |