Fenomén Býčí skála: krajina, jeskyně a člověk = The phenomenon of Býčí skála cave : lanscape, cave and mankind
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | Czech |
| Veröffentlicht: |
Praha
NLN, s.r.o.
2019
|
| Ausgabe: | Vydání první |
| Schriftenreihe: | Archeologica
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis Literaturverzeichnis Abstract Register // Gemischte Register |
| Beschreibung: | 262 Seiten Illustrationen, Karten, Pläne 24 cm |
| ISBN: | 9788074224201 |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV046448999 | ||
| 003 | DE-604 | ||
| 005 | 20201222 | ||
| 007 | t | ||
| 008 | 200228s2019 a||| |||| 00||| cze d | ||
| 020 | |a 9788074224201 |9 978-80-7422-420-1 | ||
| 035 | |a (OCoLC)1142790914 | ||
| 035 | |a (DE-599)BVBBV046448999 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a cze | |
| 049 | |a DE-12 | ||
| 084 | |a OST |q DE-12 |2 fid | ||
| 100 | 1 | |a Golec, Martin |d 1975- |e Verfasser |0 (DE-588)1205552987 |4 aut | |
| 245 | 1 | 0 | |a Fenomén Býčí skála |b krajina, jeskyně a člověk = The phenomenon of Býčí skála cave : lanscape, cave and mankind |c Martin Golec |
| 246 | 1 | 1 | |a The phenomenon of Býčí skála cave |
| 250 | |a Vydání první | ||
| 264 | 1 | |a Praha |b NLN, s.r.o. |c 2019 | |
| 300 | |a 262 Seiten |b Illustrationen, Karten, Pläne |c 24 cm | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 0 | |a Archeologica | |
| 546 | |a Zusammenfassung in englischer Sprache | ||
| 648 | 7 | |a Geschichte |2 gnd |9 rswk-swf | |
| 650 | 0 | 7 | |a Höhle |0 (DE-588)4025362-4 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Kultstätte |0 (DE-588)4033541-0 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Hallstattkultur |0 (DE-588)4072254-5 |2 gnd |9 rswk-swf |
| 651 | 7 | |a Mähren |0 (DE-588)4074432-2 |2 gnd |9 rswk-swf | |
| 651 | 7 | |a Böhmische Länder |0 (DE-588)4069573-6 |2 gnd |9 rswk-swf | |
| 651 | 7 | |a Tschechien |0 (DE-588)4303381-7 |2 gnd |9 rswk-swf | |
| 651 | 7 | |a Býči-skála-Höhle |0 (DE-588)4395724-9 |2 gnd |9 rswk-swf | |
| 688 | 7 | |a Hallstattzeit |0 (DE-2581)TH000003382 |2 gbd | |
| 688 | 7 | |a Tschechien |0 (DE-2581)TH000012145 |2 gbd | |
| 689 | 0 | 0 | |a Tschechien |0 (DE-588)4303381-7 |D g |
| 689 | 0 | 1 | |a Böhmische Länder |0 (DE-588)4069573-6 |D g |
| 689 | 0 | 2 | |a Mähren |0 (DE-588)4074432-2 |D g |
| 689 | 0 | 3 | |a Hallstattkultur |0 (DE-588)4072254-5 |D s |
| 689 | 0 | 4 | |a Höhle |0 (DE-588)4025362-4 |D s |
| 689 | 0 | 5 | |a Kultstätte |0 (DE-588)4033541-0 |D s |
| 689 | 0 | 6 | |a Býči-skála-Höhle |0 (DE-588)4395724-9 |D g |
| 689 | 0 | 7 | |a Geschichte |A z |
| 689 | 0 | |5 DE-604 | |
| 856 | 4 | 2 | |m Digitalisierung BSB München 25 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031860979&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 856 | 4 | 2 | |m Digitalisierung BSB München 25 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031860979&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |3 Literaturverzeichnis |
| 856 | 4 | 2 | |m Digitalisierung BSB München 25 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031860979&sequence=000005&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA |3 Abstract |
| 856 | 4 | 2 | |m Digitalisierung BSB München 25 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031860979&sequence=000007&line_number=0004&func_code=DB_RECORDS&service_type=MEDIA |3 Register // Gemischte Register |
| 940 | 1 | |n oe | |
| 940 | 1 | |n gbd | |
| 940 | 1 | |q BSB_NED_20200313 | |
| 940 | 1 | |q gbd_4_2012 | |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-031860979 | ||
| 942 | 1 | 1 | |c 930.1 |e 22/bsb |f 09014 |g 4371 |
Datensatz im Suchindex
| _version_ | 1804181012281819136 |
|---|---|
| adam_text | OBSAH Jeskyně Proeje Býčí skála fenoménem? Jak se zkoumaly jeskyně Nejen vědci Jak na jeskyně Cesta do podzemí, proměna a cesta ven Archeologie a krajina Sítě vedou do jeskyně Lidé a předměty v sítích Sítě napříč časem Od Hertoda navždy Management výzkumu 9 9 12 14 15 16 19 21 22 23 24 28 Krajina Co je to nabídka a odpověď? Krajina za humny Dvě krajiny-jeden svět Kolonizace vrchoviny Celistvý svět Býčiskalský vzorec 32 32 33 35 37 40 42 Cesta Koncept palimpsestu Útes lidských artefaktů Komunikace Cesty v laserové krajině (Jan Martínek) Dvanáct cest do Býčí skály Jeskyně na křižovatce 45 45 47 49 49 53 ЭІ Hromadění Časové periody Býčí skály Dvojrozměrná situace Stratigrafie, typologie a archivy BS 0 Přírodní nabídky jeskyně BS 1 Paleolit 55 55 ЪЬ 59 61 69 jř* “Դ
BS II Mezolit BS III Neolit BS IV Eneolit BS V Doba bronzová BS VI Doba halštatská BS VII Doba latenska BS Vlil Doba římská BS IX Doba stěhování národů BS X Raný středověk BS XI Vrcholný a pozdní středověk BS XII Renesance BS XIII Baroko BS XIV Klasicismus, romantismus BS XV Rakousko-Uhersko BS XVI První a Druhá republika BS XVII Druhá světová válka BS XVIII Třetí republika a socialismus BS XIX Nedávná minulost a současnost Praktické funkce Býčí skály v neomezeném čase Nej navštěvovanější postpaleolitická jeskyně v Moravském krasu Kauza 93 Halštatská krajina Drahanské vrchoviny a jejího úpatí 93 Halštatský nález z Býčí skály 94 Věci mužů, žen a dětí 95 Cesta ke konceptu jeskynní svatyně 102 Otázka mrtvých lidí 103 Etnograficko-archeologický model halštatská Býčí skály 106 Jeskynní nálezy v kontextu doby halštatské 107 Vesnice na úpatí (Jan Zeman) 108 Hradiště na horizontu 114 Zbraně, nádoby, vozy velmožů a šperky velmožek 117 Pohřeb velmože v Bratčicích 119 Opaskové velmožky 121 Podivné zacházení s lidmi (Pavel Fojtík - Martin Golec) 124 Uctívači lebek 124 Pohřby na sídlištích 125 Depoty (Pavel Fojtík - Martin Golec) 127
Pohled к obloze (Petr Kos - Martin Golec) Krumlovské doly Kamenné artefakty Býčí skály (Antonín Přichystal) Materie domácí a cizí Hierarchie mocných Výprava mezi cizí Keltové lapeni písmeny Lidé na jevišti Pár slov к hostům Krajina návštěv a střetávání (Klára Sovová) Krajina a lidská společenství Lidská společenství v krajině Pouta krajiny Historický exkurs Krajina poutníků Krajina vědců Eneolitická kresba z Býčí skály a otázka tzv. dunajského písma (Eva Čermáková) Dunajská civilizace Dunajské písmo Býčí skála na periferii „dunajského písemnictví Býčí skála a návrat písma zpět do divoké přírody (Eva Čermáková) „Izolace písma z živé přírody Koncept lingvistické krajiny Býčí skála jako „lingvistická krajina Plavba argonautů mezi útesy archeologie a etnologie (Peter Laučík) Krátká procházka jeskyní s Claudem Lévi-Straussem (Peter Laučík) Posvátno lidské - náboženství jako sociální fakt, jeskyně jako sociálně-prostorový fakt (Peter Laučík) Tři světy, cyklický čas a rituály obnovy světa (Peter Laučík) Na onen svět (Peter Laučík) Krajina senzitivů, černé díry a odvrácená tvář paměti místa (Peter Laučík) V bludišti podzemních labyrintů Minótaurových (Peter Laučík)
Krajiny železa vzpomínání, krajiny železa zapomínání (Peter Laučík) Rekonstrukce princezny Třetí zrození Wankelovy princezny Rekonstrukce princezny jako příběhu? Jak se dostat do dob dávno minulých? (Libor Bálák) 2D rekonstrukce Pohled z očí do očí (Eva Vaničková - Ondřej Bílek) Oděv princezny (Karina Gromer) Životní role princezny (Klára Sovová - Martin Golec) Dítě/dívka Žena Smrt princezny a odchod na onen svět (Klára Sovová - Martin Golec) Sociální prostředí princezny Pohřební ritus mimo jeskyni Oběti a pohřby v jeskyni Pohádky na závěr (Klára Sovová) Pohádky a mýty Kovář a ďábel Literatura Seznam a zdroje vyobrazení Resumé Rejstřík
LITERATURA Abram, D. 2013: Kouzlo smyslů. Vnímáni a jazyk ve více než lidském světě. Dharmagaia, Praha. Absolon, К. 1944-1945: Praehistorícký výzkum jeskyně Býčí skály na Moravě na srovnávacím základě: III. kritický příspěvek ku poznání praaurignacienu. Selbstverlag, Brünn (Brno). Absolon, K. 1970a: Moravský kras 1. Academia, Praha. Absolon, K. 1970b: Moravský kras 2. Academia, Praha. Absolonová, V. - Bednářová, V. 1971: Bibliografie Dr. Jindřicha Wankla. In: Grolich, V. (ed.) Jindřich Wankel, otec moravské prehistorie. Okresní vlastivědné museum, Blansko, s. 82-84. Adámek, F. 1961: Pravěké Hradisko u Obřan. Monografické práce Moravského muzea v Brně. Scientiae sodales - svazek 1. Krajské nakladatelství v Brně, Brno. Adámek, F. 1972: Halštatský pohřeb v Býčí skále. Okresní vlastivědné muzeum, Blansko. Agrikola, G. 2001: Dvanáct knih o hornictví a hutnictví. Montanex, Ostrava. André, Ch. C. 1804: Übersicht der Cebirgsformationen und besonders der Übergangsformation in Mähren. Zugleich als Leitfaden für denkende und forschende Besucher der mährischen Kalkhöhlen. Brünn. Bálák, L. 2016: Úvod do rekonstrukční paleoetnologie - učebnice rekonstrukční paleoetnologie pro vysoké školy, [online], [cit. 1. 10. 2019]. Dostupné z: www. anthropark.wz.cz. Barber, E. W. 1995: Women s Work. The First 20.000 Years. Women, Cloth, and Society in Early Times. W. W. Norton, New York. Barth, F. E. 1987: Die Wagen aus der Býčí skála-Höhle, Gem. Habrůvka, Bez. Blansko, ČSSR. In: Vierrädrige Wagen der Hallstattzeit. Untersuchungen zu Geschichte und Technik. Römisch-Germanisches Zentralmuseum
Monographien Band 12. Mainz, s. 103-120. Bednářová, V. 1961: Moravský kras za husitských válek. Vlastivědné zprávy z Adamova a okolí V/1, s. 4-9. Bednářová, V. 1968: Moravský kras ve starých tiscích. Vlastivědné zprávy z Adamova a okolí XII/3, s. 1-5. Belko, D. 2005: Rané náboženské formy a idey. Y MY, Bratislava. Beneš, J. - Dreslerová, D. ֊ Kuna, M. (eds.) 2003: Cesty к evropské krajině. Cesty ke kulturní krajině 2000-2003. Albersdorf. Bergier, J. - Pauwels, L. 1990: Jitro kouzelníků. Úvod do fantastického realismu. Svoboda, Praha. Boček, A. 1922: Moravský kras. Průvodce celým jeho územím a jeho krápníkovými jeskyněmi. Pavel Korber, Praha. Bouzek, J. 2011: Pravěk českých zemí v evropském kontextu. Triton, Praha. Bowie, F. 2008: Antropologie náboženství. Rituál, mytologie, šamanismus, poutnictví. Portál, Praha. Burkhardt, R. 1973: Moravský kras za druhé světové války (příspěvek к historii thematu). Sborník Okresního vlastivědného musea v Blansku 5, s. 3-14. CÍLEK, V. 2009: Orfeus. Kniha podzemních řek. Dokořán, Praha.
Çilek, V. 2013: Krajiny domova. Albatros, Praha. Çilek, V. 2014: Posvátná krajina. Eseje o místech, silách a dracích. Malvern, Olomouc. Čermáková, E. - Golec, M. 2014: Turistická kolonizace Moravského krasu ve světle eplgrafických památek Býčí skály. Český lid 101/2014, s. 459-482. Čermáková, E. - Golec, M. - Trubačova, T. - Tvrdý, Z. 2007: Kam zmizely horákovské děti? Studijné zvesti Archeologického ústavu SAV 42, s. 23-56. Černý, E. 1992: Výsledky výzkumu zaniklých středověkých osad a jejich plužln. Historicko-geografická studie v regionu Drahanské vrchoviny. Vlastivědná knihovna moravská - svazek 74. Muzejní a vlastivědná společnost v Brně, Brno. Čižmář, M. 2004: Encyklopedie hradišť na Moravě a ve Slezsku. Libri, Praha. Čižmář, M. - Čižmárova, J. 2014: Pozdně halštatský nález z Pavlovic (okr. Vyškov) a několik dalších halštatských depotů z Moravy. In: Čižmárova, J. Venclova, N. - Březinová, G. (eds.) Moravské křižovatky. Střední Podunají mezi pravěkem a historií. Moravské zemské muzeum, Brno. s. 35-56. Čižmář, Z. 1995: Das Hallstattzeitliche Gehöft in Kuřím (Vorläufige Ergebnisse der archäologischen Ausgrabungen). Pravěk - nová řada 5, s. 217-254. Čižmárova, J. - Holubová, Z. 2011: Pod nadvládou železa. In: Procházka, R. (ed.) Dějiny Brna 1. Od pravěku к ranému středověku. Statutární město Brno - Archiv města Brna, Brno. s. 319-399. Doležel, J. 2014: Proměna perspektivy: К dalším možnostem studia středověkého osídlení Drahanské vrchoviny. In: Boháčova, I. - Sommer, P. (eds.) Středověká Evropa v pohybu. К poctě Jana Klápště. Archeologický ústav AV ČR, Praha, s. 69-86.
Drozdová, E. 2007: Antropologický rozbor kosterních pozůstatků ze sídliště platěnické kultury v Prostějově-Čechůvkách, okr. Prostějov. Pravěk - nová řada 17, s. 219-222. Durkheim, É. 2002: Elementární formy náboženského života: systém totemismu v Austrálii. Οικουμένη, Praha. Dvořák, J. 1994: Obětiště lidu horákovské kultury (haistat) v jeskyni Býčí skála u Adamova. Vlastivědný věstník moravský 46, s. 349-353. Dvořáková, H. 1997: „Matičce křtinské z vděčnosti ... . Votivni obrazy z poutního kostela ve Krtinách. Folia ethnographica 31. Supplementum ad Acta Musei Moraviae LXXXII, s. 37-46. Eliade, M. 1993: Mýtus o věčném návratu. Οικουμένη, Praha. Eliade, M. 1994: Posvátné a profánní. Česká křesťanská akademie, Praha. Eliade, M. 1995: Dejiny náboženských predstáv a ideí I. Agora, Bratislava. Eliade, M. 1998: Mýty, sny a mystéria. Οικουμένη, Praha. Eliade, M. 2000: Kováři a alchymisté. Argo, Praha. Eliade, M. 2011: Mýtus a skutečnost. Οικουμένη, Praha. Eriksen, T. H. 2008: Sociální a kulturní antropologie. Příbuzenství, národnostní příslušnost, rituál. Portál, Praha. Fojtík, P. 2007: Uniformita pohřebního ritu platěnické kultury - realita nebo mýtus? (Úvahy nad lidskými skelety na halštatském sídlišti v Prostějově-Čechůvkách, okr. Prostějov). Pravěk - nová řada 17, s. 195-217. von Franz, M. L. 1998: Psychologický výklad pohádek. Portál, Praha. Frazer, J. G. 1994: Zlatá ratolest. Mladá fronta, Praha.
Galuska, L. 2006: Depot raně středověkých předmětů od Býčí skály v Moravském krasu. In: Zábojník, J. (ed.) Aevum Medium - zborník na počest Jozefa Hošša. Univerzita Komenského, Bratislava, s. 23-29. Gimbutas, M. 1989: The Language of the Goddess. Thames and Hudson, London. Gimbutas, M. 2000: Das Ende Alteuropas. Der Einfall von Steppennomaden aus Südrussland und die Indogermanisierung Mitteleuropas. Archaeolingua - Series Minor 6. Archaeolingua, Budapest. Glob, P. V. 1972: Lidé z bažin. Lidé doby železné uchovaní po dva tisíce let. Odeon, Praha. Gojda, M. 2000: Archeologie krajiny. Vývoj archetypu kulturní krajiny. Academia, Praha. Gojda, M. et al. (Gojda, M. - John, J. - Stárková, L. - Brejcha, R. - Bureš, M. Čapek, L. - Fröhlich, J. - Hlásek, D. - Holata, L. - Koscelník, P. - Malina, O. Menšík, P. - Plzák, J. - Prostředník, J. - Ramminnger, B. - Stolz, D. ֊ Šída, P.) 2010-2012: Potenciál archeologického výzkumu krajiny v ČR prostřednictvím dálkového laserového 3-D snímkování (LIDAR). Nepublikovaný projekt GAP405/10/0454. Poskytovatel dotace: Grantová agentura České republiky. Golec, M. 2005: Horákovská kultura. Nepublikovaný rkp. dizertace ÚAM FF MU Brno. Golec, M. 2007: Chronologie horákovské kultury aneb stupně v pohybu. Pravěk nová řada 15, s. 419-446. Golec, M. 2014a: Jeskyně Býčí skála a její okolí ve středověku. Pravěk- nová řada 22, s. 345-368. Golec, M. 2014b: Trampové v Býčí skále v 30.-40. letech 20. století, [online], [cit. 1. 10. 2019]. Dostupné z: www.byciskala.cz. Golec, M. 2014c: Vranovsko-křtinský lichtensteinský areál. Acta Musei Moraviae, Scientiae
sociales XCIX/2, s. 235-250. Golec, M. 2017: The Phenommenon of the Býčí Skála Cave. Landscape, Cave and Mankind. Archaeologica Olomucensìa I. Olomouc. Golec, M. - Čermáková, E. - Fojtík, P. 2017: Vekerzugský kmenový svaz na Moravě? Pravěk - nová řada 24, s. 175-200. Golec, M. - Fojtík, P. 2020: Centrum platěnické skupiny východohalštatské kultury na Moravě. Archaeologica Olomucensia V. Olomouc. Golec, M. et al. (Golec, M. - Kána, V. - Pekárek, A. - Roblíčková, M. Kratochvíl, R. - Kaplan, P. - Šebeček, V. - Mátl, Š. - Svozil, J. Ѕт. - Kosina, К. Tůma, А.) 2015: Býčí skála. Jeskyně a člověk - příroda a kultura. IO ČSS 6-01 Býčí skála, Blansko. Graça da Silva, S. - Tehrani, J. J. 2016: Comparative phylogenetic analyses uncover the ancient roots of Indo-European folktales, [online], [cit. 1. 10. 2019]. Dostupné z: www.rsos.royalsocietypublishing.org. Graf, A. 1910: Pohledy a potulky po Moravském Švýcarsku II. Býčí skála v Josefském údolí (s půdorysem). Antonín Okáč, Královo Pole u Brna. Gregor, V. A. - Pípal, V. - Pokorný, P. 2012: Historie a vývoj horolezectví v Moravském krasu. Sborník Muzea Blansko 2012, s. 30-48. Grimm, J. - Grimm, W. 1812: Kinder- und Haus-Märchen. Band 1. Realschulbuchhandlung, Berlin. Haarmann, H. 2002: Geschichte der Schrift. C. H. Beck, München.
Hald, M. 1980: Ancient Danish Textiles from Bogs and Burials. A Comparative Study of Costume and Iron Age Textiles. National Museum of Denmark, Copenhagen. Havelka, J. 1886: Čelnější památky moravské doby kovové. Časopis Vlasteneckého spolku musejního v Olomouci 3, s. 1-11, 81-84, 107-115. HÉRODOTOS 2005: Dějiny aneb Devět knih nazvaných Músy. Academia, Praha. Hertod a Todtenfeld, J. H. 1669: Tartaro-Mastix Moraviae per quem rariora et admiranda a natura in faecundo hujus regionis gremio effusa, comprimis tartarus, illiusque effectus morbosi curiose examinantur, et cura tarn therapeutica quam prophylactica proponitur. Susann ae Rickesin Viduae, Viennae. Hodder, I. 2012: Entagled. An Archaelogy of the Relationships between Humans and Things. Wiley-Blackwell, Singapore. Hoššo, J. 1975: Kostolné cintoríny v Liptovskej Mare a Liptovskej Sielnici (výsledky historickoarcheologického výskumu). Liptov 3, s. 121-166. Hübschmannová, M. 1973: Rómske pohádky. Odeon, Praha. Húrban, M. J. 1841: Cesta Slowáka ku Bratrům Slawenským na Moravě a w Čechách. Trattner-Károly, Pesst. Janeček, P. (ed.) 2011: Folklor atomového věku. Kolektivně sdílené prvky expresívni kultury v soudobé české společnosti. Národní muzeum - Karlova univerzita, Praha. Jarůšková, Z. - Strof, A. (eds.) 2014: Pravěk Boskovická. Vlastivěda Boskovická 3, Boskovice. Jurende, C. J. 1809: Die mährischen Kalkhöhlen. Die Begčiskala, die schönste und zugängliche Höhle Mährens. Jurende s Mährischer Wanderer I. Kandert, J. 1982: Poznámky к využití etnografických údajů v případě výkladů knovízských „hrobů . Archeologické rozhledy
XXXIV, s. 190-200. Kavička, K. 2014: Poutní a farní chrám Páně jména Panny Marie ve Krtinách. Kartuziánske nakladatelství, Brno. Kern, A. 2001: Trink- und Speisesets. Hallstattzeitliche Besttatungssitten am Beispiel eines Grabes aus dem Hallstatätter Gräberfeld. In: Daim, F. - Kühtreiber, T (Hrsg.) Sein Sinn/Burg Mensch. Katalog des Niederösterreichischen Landesmuseums - Neue Folge 434. Niederösterreichisches Landesmuseum, St. Pölten, s. 105-118. Kirchmayr, H. 1893: Der altdeutsche Volksstamm der Quaden II. Breitkopf und Härtel, Leipzig. Kolář, F. 2002: Životní styl halštatské a časně laténské aristokracie - možnosti interpretace. In: Kazdová, E. - Podborský, V. (eds.) Studium sociálních a duchovních struktur pravěku. Masarykova univerzita, Brno. s. 285-329. Kollár, J. 2001: Slávy dcéra. Dielo I. Básne. Slovenský Tatran, Bratislava. Konečný, L. - Merta, J. 1976: Zjišťovací průzkum středověkých fortifikací v okolí Nového hradu u Adamova. Archaeologia historka 1, s. 246-249. Konečný, L. - Merta, J. 1980: Pokračování průzkumu středověkého opevnění kolem Nového hradu u Adamova. Archaeologia historica 5, s. 305-319. Kos, P. ֊ Přichystal, M. 2013: Doba halštatská. In: Geislerová, K. - Parma, D. (eds.) Výzkumy 2005-2010. ÚAPP Brno, Brno. s. 74-94. Kostrhun, P. 2014: Cesty moravské paleolitické archeologie v období Československé republiky. Moravské zemské muzeum, Brno.
Koudelka, F. 1889: Ze zapomenutého kraje Moravy. Jeskyně údol! Hádeckého. O. Sadovský, Ivančice. Kozák, J. (ed.) 2009: Atlas půd České republiky. Česká zemědělská univerzita, Praha. Kreps, M. 1976: Dějiny adamovských železáren a strojíren do roku 1905. Blok, Brno. Kroupa, J. 2009: Brno v době baroka. In: Svobodová, J. (ed.) Baroko. Příběhy barokního Brna. Muzeum města Brna, Brno. s. 10-31. KŘÍŽ, M. 1892: Die Höhlen in der Mährischen Devonkalken und ihre Vorzeit II. Jahrbuch der k. k. geologischen Reichsanstalt 42, s. 463-626. KŘÍŽ, M. - Koudelka, F. 1902: Průvodce do Moravských jeskyň, II. díl. Vlastní náklad, Ždánice - Vyškov. Kuckenburg, M. 2004: Die Kelten in Mitteleuropa. Konrad Theiss, Stuttgart. Kučera, В. - Slezák, L. - Hromas, J. 2009: Poznávání, využívání a ochrana jeskyní. In: Hromas, J. (ed.) Jeskyně. Chráněná území ČR XIV. Agentura ochrany přírody a krajiny ČR, Praha. s. 117-128. Kunov, A. - Arnaudov, V. - Molnar, M. 2014: First 14C dating of the bat guano used for the ancient drawings of Magura cave, NW Bulgaria. In: Yanev, Y. (ed.) National Conference with international participation “Geosciences 2014 . Bulgarian geological Society, Sofia, s. 111-112. Landry, R. - Bourhis, R. Y. 1997: Linguistic landscape and ethnolinguistic vitality. An empirical study. Journal of Language and Social Psychology 16, s. 23-49. Langhammerová, J. 2004: Lidové zvyky: výroční obyčeje z Čech a Moravy. Lidové noviny, Praha. Laučík, P. 2015: Kultúrna dimenzia jaskýň na Slovensku I. Základy etnológie podzemia. Občianske združenie Salvátor, Vyšná Boca. Lazarovici, C. M. 2008: Symbols
and Signs of the Cucutem-Trypolje Culture. The Journal of Archaeomythology 4, s. 65-93. Lazarovici, C. - Lazarovici, C. M. - Merlini, M. 2011: Tartaria and the Sacred Tablets. Editura Mega, Cluj - Napoca. Lévi-Strauss, C. 1966: Smutné tropy. Odeon, Praha. von List, C. 1899: König Vanius. Ein deutsches Königsdrama. Verein Deutsches Haus, Brünn. Liška, V. 2012: Nejděsivější místa české historie. Po stopách tajemných míst s ozvěnou času. Χ,Υ,Ζ, Praha. Lucke, W- Frey, O.-H. 1962: Die Situla in Providence (Rhode Island). RömischGermanische Kommission, Forschungen 26. Walterde Gruyter, Berlin. Mabille, P. 1938: Égrégores ou la Vie des civilisations. J. Flory Éditeur, Paris. Malinowski, В. К. 1922: Argonauts of the Western Pacific. An Account of Native Enterprise and Adventure in the Archipelagoes of Melanesian New Guinea. G. Routledge, London. Martínek, J. ֊ Šlézar, P. 2014: Po stopách starých cest. Výsledky projektu „Výzkum historických cest v oblasti severozápadní Moravy a východních Čech . Výstavní katalog. Centrum dopravního výzkumu, Brno. Martínek, J. a kol. (Martínek, J. - Kubeček, J. - Látal, M. - Ambrož, J. Peška, J. - Kalábek, M. - Vrána, J. - Šmeral, J. - Šlézar, P. - Babek, O. Létal, A. - Miřijovský, J. - Vích, D.) 2011-2014: Výzkum historických cest v oblasti severozápadní Moravy a východních Čech. Nepublikovaný projekt v rámci 239
Programu aplikovaného výzkumu a vývoje národní a kulturní identity (NAKI). Poskytovatel dotace: Ministerstvo kultury České republiky. Martínek, J. et al. 2013: Moderní metody identifikace a popisu historických cest. Metodická příručka. Centrum dopravního výzkumu, Brno. Matoušek, V. 2005: Bacín - brána podzemí. Archeologický výzkum pravěké skalní svatyně v Českém krasu. Krigl, Praha. Matoušek, V. - Jenč, P. - Peša, V. 2005: Jeskyně Čech, Moravy a Slezska s archeologickými nálezy. Libri, Praha. Mauss, M. 2003: On Prayer. Berghahn Books, New York. Merlini, M. 2005: The Danube Script and the Cradesnica platter. A somatic Study based on most recent autopsy on the Bulgarian item. In: Nikolova, L. ֊ Higgins, J. (eds.) Prehistoric Archaeology Anthropological Theory and Education. Report of Prehistoric Research Projects 6-7. International Institute of Anthropology and Prehistory, Salt Lake City. s. 59-78. Merlini, M. 2008: Challenging Some Myths About the Tartaria Tablets Icons of the Danube Script. The Journal of Archaeomythology 4, s. 47-64. Merlini, M. 2009: An Iquiry into the Danube Script. Ed Altip, Sibiu. Merta, J. 2006: Železářství Moravského krasu. Ochrana přírody 61, s. 247-250. Merta, J. 2012: Obecné počátky přímé výroby železa a její vývoj na našem území. Archeologia technica 23, s. 3-20. Messaidé, G. 1996: Obecné dějiny dábla. Argo, Praha. Mihola, J. 2010: Vranov и Brna. Mariánské poutní místo, paulánský klášter, hrobka Lichtenštejnů. Jiří Brauner - Kartuziánske nakladatelství Brno, Vranov u Brna. Mírová, Z. 2019: The horse in the Bronze and Iron Age in Moravia.
Archaeologica Olomucensia Tomus III. Olomouc. Mírová, Z. - Golec, M. 2018: Hallstatt Magnate Graves from Brno-Holásky 1 and 2 in Central European Context. Archaeologiae Regionális Fontes 13. Olomouc. Musil, R. 2010: Výpustek. Bájná jeskyně u Křtin. Její 400letá historie a význam. Acta speleologica 1. Správa jeskyní České republiky, Průhonice. Nakonečný, M. 1997: Lexikon Magie. Ivo Železný, Praha. Nakonečný, M. 2013: Lexikon psychologie. Vodnář, Praha. Německý, M. 2006: Pojetí politična v politické antropologii. Historická sociologie 4. [online], [cit. 1. 10. 2019]. Dostupné z: www.clovek.ff.cuni.cz. Neústupný, E. 2007: Vymezení archeologie. In: Kuna, M. (ed.) Archeologie pravěkých Čech 1. Pravěký svět a jeho poznání. AÚ AV ČR Praha, Praha. s. 11-22. Neústupný, E. 2010: Teorie Archeologie. Aleš Čeněk, Plzeň. Neústupný, J. 1941: Pohřbívání žehem v pravěku Čech a Moravy. Život a práce, Praha. Norberg-Schulz, Ch. 2010: Genius loci. Krajina, místo, architektura. Dokořán, Praha. Novotný, V. - Králík, M. - Malá, P. - Kotrla, J. 2003: Tváří v tvář našim předkům. (Re)konstrukce a experiment v archeologii 4, s. 53-69. Odehnal, F. 2008: Poutní místa Moravy a Slezska. Kartuziánske nakladatelství Brno, Brno. Oliva, M. 1995: Starší doba kamenná (paleolit) na Moravě. In: Podborský, V. (ed.) Sborník příspěvků proslovených na I. obnoveném sjezdu Moravskoslezského
archeologického klubu v Moravských Budějovicích 16.-17. srpna 1995. Masarykova univerzita, Brno. s. 33-42. Oliva, M. 1996: Spodní paleolitická vrstva z Býčí skály. К poznání mýtotvorných procesů v naší speleoarcheologii. Acta Musei Moraviae - Scientiae sociales LXXXI, s. 37-59. Oliva, M. 2001: Mýtus masového hrobu z Předmostí u Přerova. К pohřebním zvyklostem moravského gravettienu. Archeologické rozhledy Lili, s. 3-29. Oliva, M. 2005: Civilizace moravského paleolitu a mezolitu. Moravské zemské muzeum, Brno. Oliva, M. 2010: Pravěké hornictví v krumlovském lese. Studies in Anthropology, Palaeoethnology, Palaeontology and Quaternary Geology - Volumen 32. Moravské zemské muzeum, Brno. Oliva, M. - Golec, M. - Kratochvíl, R. - Kostrhun, P. 2015: Jeskyně Býčí skála ve svých dějích a pradějích. Studies in Anthropology, Palaeoethnology, Palaeontology and Quaternary Geology - Volumen 39. Moravské zemské muzeum, Brno. Oliva, M. - Kostrhun, P. eds. 2017: Heinrich (Jindřich) Wankel. Ephemeriden aus meinem Leben/Efemeridy z mého života. Moravské zemské muzeum, Brno. Ondroušková, S. 2011: Pravěk Moravského krasu (neolit- doba stěhování národů). Nepublikovaný rkp. magisterské diplomové práce ÚAM FF MU Brno. Ovídius, P. N. 1969: Proměny. Odeon, Praha. Parzinger, H. - Nekvasil, J. - Barth, F. E. 1995: Die Býčí skála-Höhle. Ein hallstattzeitlicher Höhlenopferplatz in Mähren. Römisch-Cermanische Forschungen - Band 54. Philipp von Zabern, Mainz am Rhein. Pauknerová, К. 2012: Fenomenologický výzkum archeologické lokality. Příklad neolitických areálů jižně od soutoku Úhlavy a Radbuzy. Sborník
prací filozofické fakulty brněnské univerzity M 17, s. 142-149. Pavelčík, J. 1983: Drobné terrakoty z Hlinská u Lipníku (okr. Přerov) II. Památky archeologické LXXIV, s. 295-315. Pelíšek, J. 1949: К charakteristice jeskynních sedimentů Býčí skály v Moravském krasu. Československý kras 2, s. 249-254. Peša, V. 2006a: Jižní boční síň a halštatské využívání Býčí skály v Moravském krasu. Archeologické rozhledy LV lil, s. 427-446. Peša, V. 2006b: Využívání jeskyní v mladší době bronzové až halštatské ve vybraných oblastech střední Evropy. Památky archeologické XCVII, s. 47-132. Peša, V. 2013: Der neuzeitliche Mensch in der Höhle: Die Speläoanthropologie als archäologische Quelle, Památky archeologické CIV, s. 231-316. Peša, V. 2014: Jeskyně v neolitu a časném eneolitu mezi Předním východem a střední Evropou - chronologie, funkce a symbolika, Acta Musei Moraviae Scientiae sociales XCIX, s. 169-210. Plaček, M. 2002: Ilustrovaná encyklopedie moravských hradů, hrádků a tvrzí. Libri, Praha. Platón 1981: Dialogy. Tatran, Bratislava. Podborský, V. 2006: Náboženství pravěkých Evropanů. Masarykova univerzita, Brno. Podborský, V. a kol. 1993: Pravěké dějiny Moravy. Vlastivěda moravská. Země a lid ֊ nová řada 3. Muzejní a vlastivědná společnost v Brně, Brno. 241
POHUNEK, J. 2011: Kultura Trampu. In: Janeček, P. (ed.) Folklor atomového věku. Kolektivně sdílené prvky expresívni kultury v soudobé české společnosti. Národní muzeum ֊ Karlova univerzita, Praha. s. 65-88. Poulík, J. 1956: Z hlubin věků. Mladá fronta, Praha. Přibyl, M. 2004: Jeskyně Výpustek. Pozoruhodný příklad symbiosy jeskyně a člověka. Krasová deprese 10, s. 46-58. Přichystal, A. 2009: Kamenné suroviny v pravěku východní části střední Evropy. Masarykova univerzita, Brno. Přichystal, A. - Náplava, M. 1995: Záhada Býčí skály aneb jeskyně plná otazníků. Amaprint, Třebíč. Reichel, J. 2008: Kapitoly systematické sociologie. Grada, Praha. Robbins Dexter, M. 2010: The Danube script and the old European goddess. The intersection of language, archaeology and religion. The Journal of Archaeomythology 6, s. 74-83. Roger, B. 2005: Objevování alchymie. Hermovo umění v pohádkách, dějinách a zednářských rituálech. Malvern, Praha. Sádlo, J. et al. (Sádlo, J. - Pokorný, P. - Hájek, P. - Dreslerová, D. - Cílek, V.) 2005: Krajina a revoluce. Významné přelomy ve vývoji kulturní krajiny Českých zemí. Malá skála, Praha. Salaš, M. - Stuchlík, S. 2011: Civilizace doby bronzové. In: Procházka, R. (ed.) Dějiny Brna 1. Od pravěku к ranému středověku. Statutární město Brno - Archiv města Brna, Brno. s. 227-318. Scollon, R. - Scollon S. W. 2003: Discourses in Place. Language in the Material World. Routledge, London - New York. Schama, S. 2007: Krajina a paměí. Argo - Dokořán, Praha. Schefzik, M. 2006: Frühbronzezeitliche Gebäudeformen in Süddeutschland. Mit einer Gegenüberstellung des
Formenbestandes der östlich angrenzenden Kulturlandschaften. In: Blajer, W. (ed.) Z badań nad osadnictwem epoki brązu i wczesnej epoki żelaza w Europie Środkowej. Uniwersytet Jagielloński, Kraków, s. 139-158. Schmidt, C. J. 1835: Brünn und seine Umgebungen. Ludwig Wilhelm Seidel, Brünn. Skutil, Jan 1969: Bibliografie dlla univ. prof. dr. Josefa Skutila. MNV v Lomnici, Lomnice u Tišnova. Skutil, Jan 1972: Wanklova Býčiskalská nálezová zpráva z roku 1872 v přepise Josefa Skutila z roku 1938. Vlastivědná ročenka Okresního archivu Blansko 1972, s. 98-104. Skutil, Jan 1973: Jana Ferdinanda Hertoda z Todtenfeldu Tartaro-Mastix Moraviae. Sborník vlastivědného musea v Blansku 5, s. 135-140. Skutil, Josef 1950: Speleorcheologie. Československý kras 3, s. 145-152. Skutil, Josef 1970: Pravěk a časná doba dějinná Moravského krasu a středověké osídlení našich jeskyň. In: Absolon, К. Moravský kras 2. Academia, Brno. s. 315-329. Souček, I. 2015: Komplementárna a alternatívna medicína v teorii a praxi. Iris, Bratislava. SouCHOPOVÁ, V. 1986: Hutnictví železa v 8.-11. stol. na západní Moravě. Studie AÚ ČSAV v Brně XIII - svazek 1. AÚ AV Brno, Brno.
SoucHOPOvÁ, V. 1995: Počátky západoslovanského hutnictví železa ve světle pramenů z Moravy. Studie AÚ ČSAV v Brně XV - svazek 1. AÚ AV Brno, Brno. Souchopová, V. et al. (Souchopová, V. - Merta, J. - Truhlář, J. - Bálák, I. Štefka, L.) 2002: Cesta železa Moravským krasem, (více vydavatelů), Blansko. Souchopová, V. - Stránský, K. 2011: Tajemství dávného železa. Archeometalurgie objektivem mikroskopu. Technické muzeum v Brně, Brno. Soukop, J. N. 1858: Macocha a její okolí. Brno. Soukup, V. 2004: Dějiny antropologie. Karolinum, Praha. Spretnak, C. 2011: Anatomy of a backlash. Concerning the work of Marija Gimbutas. The Journal of Archaeomythology 7, s. 1-27. Stejskal, M. 2011: Labyrintem míst klatých. Přízračnou krajinou českých zemí. Eminent, Praha. Stloukal, M. - Nekvasil, J. 2015: Věčné tajemství Býčí skály. Academia, Praha. Svoboda, J. A. - van der Plicht, H. - Bálák, I. 2005: Býčí skála. Prvé datování skalních maleb. Vesmír 84, s. 574-575. Šíma, J. 2009: Abeceda leteckého laserového skenování. CeoBusiness 3, s. 22-25. Trampler, R. 1897: Das Josefs-Kiriteiner Thal in der Mährischen Schweiz. Österreichische Touristen-Zeitung XVII, s. 193-195, 203-207. Trebsche, P. 2011: Die Architektur der ältereisenzeitlichen Siedlung von Prag 9 - Miskovice. Zu einem neuen Gebäudetyp mit elliptischer Palisade. Památky archeologické CII, s. 217-270. Tylor, E. В. 1897: Anthropologie. Úvod do studia člověka a civilizace. Jan Laichter, Praha. Urban, J. - Golec, M. - Tvrdý, Z. 2009: Lebky z Býčí skály. Acta Musei Moraviae Scientiae sociales XCIV, s. 163-200. Urbanová, P. 2000: Sociální struktura
lidu s horákovskou kulturou I. a II. Nepublikovaný rkp. ročníkové (bakalářské) práce KA Př.F MU Brno. Uther, H.-J. 2004: The types of international folktales. A classification and bibliography. Parts /-///. Folklore Fellows Communications, Helsinki. Valoch, К. 1988: Die Erforschung der Kúlna-Höhle 1961-1976. Anthropos. Studien zur Anthropologie, Paläoethnologie, Paläontologie und Quartärgeologie - Band 24. Moravské muzeum Brno, Brno. Vaníčková, E. 2009: Antropologická rekonstrukce podoby člověka podle lebky. Pohřebiště: Znojmo Hradiště. Nepublikovaný rkp. diplomové práce ÚA Př.F MU Brno. Vašíček, S. - Pekárek, A. 2003: Záhady Býčí skály, [online], [cit. 1. 10. 2019]. Dostupné z: www.byciskala.cz. Vogt, J. G. 1729: Boemia et Moravia subterranea. Manuscript, Plasiy. Votruba, A. 2011: Kultura vojáků základní služby. In: Janeček, P. (ed.) Folklor atomového věku. Kolektivně sdílené prvky expresívni kultury v soudobé české společnosti. Národní muzeum - Karlova univerzita, Praha. s. 39-64. Vrtbovská, P. 2005: Pohádka jako fenomén. Srovnávací výklad pohádek. Nepublikovaný rkp. disertační práce FF Karlovy univerzity Praha. Wankel, H. 1871: Prähistorische Alterthůmer in den mährischen Höhlen. Mitteilungen der Anthropologischen Gesellschaft in Wien I, s. 266-281, 309-314, 329-343.
Wankel, H. 1872: Kleinere Mitteilungen II. Mitteilungen der Anthropologischen Gesellschaft in Wien II, s. 307-312. Wankel, H. 1875a: Die Höhle bei Býčí skála. Tageblatt der 48. Versammlung deutscher Naturforscher und Aertze in Graz 5, s. 169-175. Wankel, H. 1875b: Über die Gleichzeitigkeit der Menschen mit dem Mammut und über des Fundes in der Býčí skála-Höhle in Mähren. Tageblatt der 48. Versammlung deutscher Naturforscher und Aertze in Graz 6, s. 190-192. Wankel, H. 1877: Der Bronze-Stier aus der Býčí skála-Höhle. Karl Gerold s Sohn, Wien. Wankel, H. 1882: Bilder aus der Mährischen Schweiz und ihrer Vergangenheit. A. Holzhausen, Wien. Wankel, J. 1972: Bronzový býček z jeskyně Býčí skála. Sborník Okresního vlastivědného musea v Blansku 4, s. 91-110. Wankel, J. 1973: Pravěké starožitnosti v moravských jeskyních. (Přeložili V. Grolich - J. Urban). Sborník Okresního vlastivědného musea v Blansku 5, s. 147-172. Wankel, J. 1987: O současnosti člověka s mamutem a o výsledcích nálezu v jeskyni Býčí skála na Moravě. (Přeložili V. Grolich - J. Urban). Regionální sborník okresu Blansko 87, s. 71-73. Wankel, J. 1988: Obrazy z Moravského Švýcarska a jeho minulosti. (Přeložili V. Grolich - O. Svoboda-J. Urban). Muzejní a vlastivědná společnost, Brno Okresní muzeum, Blansko. Wankel, J. 1989: Drobnější zprávy II. (Přeložili V. Grolich -J. Urban). Regionální sborník okresu Blansko 89, s. 83-85. Wankel, J. 1990: Jeskyně u Býčí skály. (Přeložili V. Grolich - J. Urban). Sborník Okresního muzea Blansko 90, s. 68-73. Wolny, G. 1837: Die Markgrafschaft Mähren, topografisch, statistisch und
historisch geschildert II, Brünner Kreis. Selbstverlag, Brünn. Zeman, J. 2015: Sídelní struktury dvorce horákovské kultury v Kuřími, okr. Brnovenkov. Nepublikovaný rkp. magisterské diplomové práce ÚAM FF MU Brno.
RESUMÉ THE PHENOMENON OF BÝČÍ SKÁLA CAVE. LANSCAPE. CAVE AND MANKIND THE CAVE What makes Býčí skála Cave a phenomenon? In 1872, Heinrich Wankel could not have anticipated that in Moravian Karst, north of Brno (Fig. 1), he would discover the richest Moravian location of Hallstatt culture of all times. Býčí skála (Bull Rock) is unique through its mobile and immobile parameters. This book understands cave as a natural space which is, nevertheless, formally utilized by people as a building - making it a stone house (Fig. 2). Caves are not isolated from the landscape: they are always part of larger world. A cave differs from other types of aboveground landscape (e.g. settlements). Why do people enter it? By its nature, a cave is always open for entry - even invites it. The landscape specificity of caves deserves a special approach, one that reflects both their natural and their cultural aspects: speleoarchaeology. Any cave is always explored in three stages: the descent underground, the metamorphosis and the journey back outside. Assuredly, science partakes in this constant process (Fig. 3). Spatial, landscape relations can also be studied by landscape archaeology. Human activity and social networks play out in the landscape, forming important hubs. These networks also reach caves. The everyday symbiosis of mankind and artefacts leads people to carry them everywhere, including underground. Landscape, mankind and artefact form an integrated world. A cave remains very stable through changing times; people keep their knowledge of it and even have reasons to visit it time and time
again (Fig. 4-5). The scientific interest in caves comes from many directions: often it is through natural science and sometimes scientists come looking for signs of cultural dimension. We choose to start with the combined approach of speleoarchaeology (Fig. 6). THE LANDSCAPE What is a challenge and what is a response? From birth to death, every per son gets confronted with challenges. One might say that there is no effect (response) without a cause (challenge). The interaction between responses and challenges happens within the relationship of person/person or person/ landscape. Býčí skála lies in Drahanská vrchovina (Drahany Upland), which has been left uninhabited for most of the prehistoric period (Fig. 7). Howe ver, people did live there from time to time, knew about it and used it, just like they did with the integrated landscape. People moved to the Drahany Upland for limited periods of time and then they returned home to the fertile lowlands around. Temporary enclave settlements appeared from time to time, but only in High Middle Ages does the Drahany Upland become permanently settled. Since prehistoric times, the borders of the Drahany Upland with its convenient proximity to both types of terrain provided locations for hillforts, later fortresses and castles. The Drahany Upland was colonized from the plains time and time again. The same goes for other types of secondary colonization
like Christian, industrial, touristic or sports. A cave is a part of the integrated world, it belongs among all of the landscape spaces, including the unattai nable aboveground (sky) and the reachable underground. Some parts of the world are spatially undefined; atypical example of this is the hereafter, usually situated outside the central world we inhabit. Cave in its function of a stone house has held human visits for various lengths of time. Cave space has three main functions in human lives: practical, social and symbolical. A big cave like Býčí skála often used to provide a multi-community (belonging to multiple communities) area in landscape - and still does. THE ROAD To understand the cultural meaning of landscapes, it is useful to see land as a parchment - palimpsest. Even though the base remains, the original record is gradually scraped off and replaced with a new one, while parts of the original stay visible (Fig. 8-9). Individual landmarks commonly gain new practical uses, particular cultural interferences inspire new responses, forming and reshaping the landscape. An unpopulated or sparsely populated country s most frequent artefact is the road (communication), in most cases spontaneously created. Roads in general facilitate communication between people and landscape elements, such as caves, as well as between people themselves. In the Drahany Upland area, several historical roads of local and long-distance character have been identified, many of which pass in close proximity to Býčí skála. The best known of these roads is probably the north-south Amber Road,
crossing the west-east Pannonia-Elbe Road. Long-distance roads enter the southern Drahany Upland from the surrounding plains in nine cases and in three cases from its northern part. There are twelve gateway routes in total. These roads gradually unite on their way to the centre of southern Drahany Upland, finally forming a crossroads in Krtiny in the central part of the Moravian Karst, next to the abovementioned Býčí skála (Fig. 10). Caves as stone houses used to play a remarkable part in the traffic network overlay of a landscape. Many of them lay by the roadside . Roads lead us to them and allow us to step inside (Fig. 11). ACCUMULATION The timeline of Býčí skála uses the basic periodization of the history of the Czech lands, with some Moravian specifics. The archaeological discoveries are divided into nineteen periods from the Palaeolithic to the Present - Býčí skála BS l-XIX (Fig. 12). BS 0 is the empty cave as understood by geology or karsology. Archaeological situations of post-Palaeolithic period come from the excavations of Heinrich Wankel (Fig. 13-14) and then from the times right before and during WWII (Fig. 15). The natural dispositions of cave BS 0 ֊ were challenges met with human response. These are absolutely crucial to our understanding of the cave s cultural dimension, and yet they are often completely overlooked. A cave s disposition includes various features: size; horizontality/verticality; open/closed access from its surroundings; entrances (Fig. 2); operational space inside and outside; orientation; prominence; safe ty; proximity to roads, human
dwellings and other opportunities; visibility;
temperature; circulation of air; humidity; sound; water access; soil; bedrock; raw materials; food/drink and fuel; special effects/features (Fig. 16) or sto ries. BS I - Palaeolithic (15,000-13,000 BC), the first humans in Býčí skála belonged to the Magdalenian culture, hunting reindeer and horses. Their winter camp, located in the darkness of Jižní odbočka (South Branch) far from the entrance, lay in a place that never froze (Fig. 17). BS II - Mesolithic (10,000-5700 BC), did not provide any proofs of human presence. BS III Neolithic (5700-4200 BC), after long pause, people returned to the cave. All of the Neolithic cultures make appearance in succession - Linear Pottery culture, Želiezovce group, Šárka phase, Stroke-Ornamented Ware culture and Lengyel culture. Rich Neolithic findings come from nearby Výpustek Cave, it also served as a burial place (Fig. 18). BS IV - Eneolithic (4200-2200 BC), also present, with ceramics representing multiple cultures. The three distinct cultures of large time span were Jordanow culture/Boleráz type, Baden culture and Jevišovice culture. A noteworthy find from the period of 3330-2915 BC is a unique charcoal painting belonging to the Baden culture, it can be found in a vagina-shaped cavern in the far end of the cave s South Branch (Fig. 19), we interpret it as a religious offering to the “Mother Goddess . BS V - Bronze Age (2200-800 BC), again, several cultures have left their mark in the form of many large pottery finds. These are Únětice culture, Middle-Danube Tumulus culture, Velatice and Podolí phases of the Middle-Danube Urnfield
culture. BS VI - Hallstatt Period (800-450 BC), is a true Býčí skála phenomenon, with frequent representations of the elites. It is explored in greater detail in the fifth and seventh section of this book. This find has the longest story of reinter pretation of any prehistoric excavation site in Moravia. The public would best know it as Wenkel s discovery of Hallstatt nobleman s burial (Fig. 20), but this publication s authors view it differently now. BS VII - La Tene (450-9/6 BC), Early Iron Age is far less represented than Hallstatt culture, only few artefacts have been found in the cave. BS VIII - Roman Period (9/6 BC-AD 375), a large pottery collection found in the cave is a mix of local German production and of Roman production from the faraway workshops of the Roman provinces south of Danube. BS IX-Migration Period (375-600), no proven finds. BS X - Early Middle Ages (600-1250), Býčí skála locality became a strategic point for its rich deposits of iron ore. Its use in local bloomeries started already in the eighth century, before the Great Moravian period. The ninth century even brought series of iron-smelting furnaces near today s Olomučany; the finished products were then further distributed into Great Moravian centres. A small ceramics collection comes from Býčí skála. BS XI - High and Late Middle Ages (1250-1500), these periods are mostly represented by large amounts of pottery. The preserved fragments of stove tiles also document possible human presence in the war years of 1470-1471. The South Branch also contained unstamped silver rounds; they could be the
remains of the work of coin forgers. Another item found there is a drawing of an animal, a deer maybe, radiocarbon dated to 1275-1395. BS XII - Renaissance (1500-1620), no traces left in the cave, however, written sources from the first half of the sixteenth century mention the existence of “Althamr , an iron-producing site nearby. At any point in time, the cave could also have been utilized for diverse economic purposes. BS XIII - Baroque (1620-1750), for the first time, the written sources specifically mention Býčí skála. In 1669, Johann Ferdinand
Hertod of Todtenfeld describes his exploration of the cave in great detail, he also mentions that the cave used to house a hermit (Fig. 21). BS XIV - Clas sicism, Romanticism (1750-1868), the area between Vranov near Brno and Krtiny underwent large-scale romanticising adjustments under the direction of Pozořice estate s owners, the Liechtensteins. The whole area has recently been officially named the Vranov-Křtiny Liechtenstein Complex. Emperor Francis II visited the area and the cave on September 7, 1804 (Fig. 22). Býčí skála Cave was a free tourist complex. It can be described as an open cave an intercommunity landscape centre. BS XV-Austria-Hungary (1868-1918), this period has left behind far richer historical sources. The cave attracted intensive scientific scrutiny; archaeology in particular since 1867/1868. In 1872, Heinrich Wankel uncovered a rich Hallstatt situation in the Entrance Hall (Fig. 23). German speleologists from Brno come to the cave around year 1900. BS XVI - First and Second Republic (1918-1939), intermittent archaeological and speleological surveys continue. The underground gets frequently visited by Czech tramps. BS XVII - Second World War (1939-1945), after a relatively calm period during the first part of the war, a change came in 1944, when the Entrance Hall underwent quick adjustments for wartime arms production (Fig. 24). BS XVIII -Third Republic and Socialism (1945-1989), the cave s speleo logical exploration sources of this period are also part of today s living culture. Shortly after the war ended, the cave became the official workplace of
the Speleological Club in Brno. A newly established speleological club of ADAST Adamov started its work there in 1954 and continues to explore the cave until today. BS XIX - Recent Past (after 1989) and the present, the intensive speleological explorations in Býčí skála and Barová Cave continue (Fig. 25), the cave also holds the interest of other scientific disciplines as well as of the general public, whose entry into the cave is forbidden. Still, a Visitor s Day at Býčí skála is usually held in the spring and selected chapters of its history are presented to the public. A “locked cave intercommunity landscape centre can be introduced. The observation of the multifunctional role of Býčí skála in time points to four practical functions: 1. visitation/inhabitation/settlement; 2. gathering/mining/production; 3. burial/sacrifice; 4. votive/sacrifice. Rich findings and sources proving human presence in Býčí skála during 16 of the 19 periods of history make it the most visited post-Palaeolithic cave of Moravian Karst. Similar development can be observed also in other large caves in the area, such as Kůlna or Pekárna. CAUSE This part aims to introduce the landscape environs of the Drahany Upland during the existence of Hallstatt discovery in Býčí skála in the sixth century BC. Its creators and owners came from this area. The primary source of the discovery circumstance in the cave are Wankel s articles from 1872-1882, mainly his Scenes from Moravian Switzerland and its Surroundings from 1882. The sources suggest the original space was organized into four distinct loca tions
with findings (Fig. 26-27). A rich collection is nowadays kept in Natural History Museum in Vienna, a smaller portion is also kept in the Moravian Museum in Brno. The objects can be divided into those that belonged to men (Fig. 28) and those that belonged to women (Fig. 29). An exceptional discovery
of six rich noblewomen graves (elites), along with some other artefacts, was made in the central portion of the Entrance Hall. The remains of craft production make a specific group. Apart from smithy (Fig. 30) we also have tools, semi-finished products and spoilage of bronze, bone (Fig. 31), amber and textile production. The Hallstatt discovery from the Entrance Hall points to a multifunctional space. Proofs of four functions can be found: 1. visitation/ settlement; 2. production; 3. burial/sacrifice՝, 4. votive/sacrifice. The collective term for these activities is cave sanctuary. The dead and their objects were interred under the Entrance Hall surface, documented by the intact or only slightly damaged pottery (Fig. 32). Thanks to the specific cave environment, this pottery has even preserved bits of food inside. While Central Europe s caves are mostly vertically oriented (shaft caves), Býčí skála is the opposite: horizontal. A sanctuary s (stone house s) function was, among others, the extensive burial (not throwing in) of the dead. Similar ways of life can be found in various localities around the Drahany Upland. On its western bor der in Kuřím, a palisaded multiphase settlement from the second half of the seventh to the sixth century BC has been explored (Fig. 33). In between the smaller aboveground post houses and granaries there is a dominant common house used by the elites (Fig. 34). This settlement had a specialized produc tion of bronze and amber. An unusual building of oval rondeloid shape (Fig. 33) and astronomical (religious) function has been discovered in
this area. The Drahany Upland s borders offered convenient locations (challenges) for hillforts (intercultural centres). Late Bronze Age central agglomerations (such as Brno-Obřany) come to an end at the beginning of Hallstatt period, only in the sixth century BC a new web of small fortifications starts to appear, conspicuously evenly spaced. These fortifications are tied to roads leading around and inside the Drahany Upland. The richest men-nobles had them selves buried in quadratic burial chambers (up to six metres long), these were houses of the dead and it is possible they had two storeys. The large size can be explained by the need to house four-wheel carriages and yokes (Fig. 36). In these graves we can find luxury items such as weapons, bronze vessels, iron spits or horse harness. Such large burial chambers were not available to the richest women-noblewomen (belt women). Their graves contained numerous jewellery (Fig. 36) and compound belts of note (Fig. 37). Býčí skála findings correspond with the discoveries made at the other Brno area gravesites of noblemen and noblewomen, thus helping us identify the area of the makers and owners of the underground sanctuary. Strange cemeteries, the so-called burial settlements such as in Prostějov-Čechůvky, appear for the whole duration of the Bronze Age and also the Hallstatt period. We have two contradictory explanations for this type of burial: either the people in these graves were punished by not having a proper gravesite and thus being forced to remain in between worlds, neither living nor dead; or these people were
sacrificed to work for their community between the worlds and thus earn their proper place in the hereafter. Beside the burials of people with grave goods, artefacts were also discovered in collections (the so-called hoards). There are food preparation/serving hoards with bronze vessels, cups, bowls, ladles, iron spits and cauldron hanging stands, also jewellery hoards with compound belts, hooks, armbands, bracelets and beads made from amber, glass or mother-of-pearl. A find of 150 bracelets and armbands points to a so
far unidentified local depot phenomenon in Býčí skála. This occurrence signi fies a connection not to the south Moravian Horákov group of East Hallstatt culture, but to the central Moravian Platěnice group of the same culture (Fig. 40). Circular rondels and irregular rondeloids offer an interesting insight into the spiritual world of the Hallstatt period. One particular rondel with double gate and astronomical orientation at the largest Horákov group cemetery in Modrice (Fig. 38) has given up three burial finds located at its outer wall which they follow. Hallstatt period chert mining has been discovered recently in the deep pits of Krumlovský les (Krumlovský forest) southwest of Brno. After these shafts had been excavated, lithic debitage was thrown back in. Such activity can be interpreted as a religious offering to the Great Mother Earth . Various stone objects from the large collection from Býčí skála have not yet been assessed (Fig. 39). The analysis of their origins shows that they were often collected in the vicinity of Býčí skála, Drahany Upland and its environs, corresponding with the movement of people coming to Býčí skála from various directions. Hallstatt artefacts from Býčí skála communities can be assessed through three points of origin. First, those that the people sourced and created locally. Second, those that they manufactured themselves, only from imported materials. And third, those they did not, could not or would not make themselves and had to trade for them. Luxury items in particular must have been imported from far away. Hallstatt period society
is consid ered highly ranked, with politics strongly permeating all layers of society and with unevenly spaced elite dwellings in the landscape. Moravian Hallstatt period societies reach the level of simple chiefdom. In the sixth century BC (Ha D1-D2) the movement of prestige items along the Amber Road through Moravia intensifies (Fig. 40). The political and economic power concentrates in the hands of the elites. In the middle of the sixth century BC, the Vekerzug culture and other cultures from the Carpathian Basin brought about a turning point into the whole eastern region of Hallstatt Central Europe. For the whole duration of its existence, Horákov group s culture shares many similarities with western and southern reaches of Hallstatt Central Europe (Fig. 41), which are ascribed to the early Celts. We have no proofs of blood relationships with their neighbours yet, but their identical cultural style links them quite clearly. Consequently, it is appropriate to consider the term early Celts in connection with Hallstatt period southern Moravia. PEOPLE ON STAGE The aim, or dream, of the humanities is not only to discuss the functional and social aspect of a cave as a stage full of cultural messages but also to uncover its deeper, religious meaning in the preindustrial society. The specific position of a cave in landscape leads scientists to look for new forms of knowledge not only in the cave itself but also through the methods of theoretical rese arch. Other disciplines lend us their methodologies - sociology, ethnography, linguistics and religious studies. Socio-
ethnographic research focuses on the subcultures connected with caves. The unique beauty of karst landscape attracts secondary inhabitants , they move in for a time and develop their colourful cultural forms - such as tramps, soldiers and pilgrims. Moravian Karst plays the role of a multifunctional playground/stage . Seen from the
point of view of the groups entering the stage, there are two basic models: first, new groups arising out of modified original groups, bringing with them their own rules and norms; second, groups formed by coalescing persons of various origins, who adopt the rules of their new social group that they also help to form. One particular discovery of Eneolithic painting in Býčí skála s South Branch, attributed to the Baden culture, led to the promulgation of an opin ion that it fits into the environment of the Danubian civilization. There is a specific semiotic system within its context and the scientific literature com monly calls it a Danube script. Býčí skála lies at the border of this written tradition . The large amount of preserved graffiti in this cave can be seen as part of a linguistic landscape closely connected to the phenomenon of tourism. Býčí skála is a place where letters originally extracted from natural signs get to be reintroduced back into the wild after a time apart, where they reunite with a unified whole. In our search for the understanding of prehistoric societies, we can rely on two main sources of information: first, the preserved fragments of material culture and sporadic written relics; second, the ethnographic re search of the so-called primitive societies . In this respect, ethnographic research starts to resemble archaeology - in both cases the studied soci ety no longer exists. The main trait of human culture is its separateness from nature. This setting apart from nature often has only one meaning in the primitive societies (as well as
among our farmers). Something gets transformed into something else through human activity, as is the case with undifferentiated nature turning into differentiated culture. Not every artefact necessarily carries such meaning as is expected of it by science. The expectation of religious context of past activities in the cave has to be put in a perspective of the systematics of religious forms and ideas accord ing to the object of worship (Fig. 42), in the direction from the concrete to the abstract, from the form to the spirit, from fetishism to panentheism. Only on the basis of practical ritual components can we formulate ideas. Religion is one of many complex social facts. It is a product of human mind and it influences its creators with great and uncompromising strength. Seeing the social facts as egregores or demons allows us to contemplate the connection between bloody sacrificial rituals in the cave and the long tradition of suicides in the nearby Macocha Abyss. To understand religious human sacrifice rituals we must reach towards the universal understanding of a layered cosmos that can be seen in the mythologies of various indige nous peoples (Fig. 43) and consider also multiple universes, or dimensions of reality (Fig. 44). The idea of the passage of the dead on to the next world is represented in the so-called cult of ancestors, ideas like this are also reflected in the usual rites of passage (funerals) or ritual sacrifice. The practice of sacrifice and the effect of violent death on the place of memory resonates with the insights of the arts, occultism and
contemporary psychotronics, whose interest this uncanny cave, a storied place of folklore, attracts from time to time (Fig. 45). Within this context we can place some of the modern phenomena of seeking out abandoned places, such as ghost hunting or urban exploration. The influence of nationalism gave rise to several ethnic reinterpretations, e.g. the Svantovit s temple . These and
other layers of new ideas are part of a larger mythological topography of landscape, they flesh out our views of its spiritual dimension, which, of course, only again follows older traditions. THE RECONSTRUCTION OF A PRINCESS Throughout the last part of this book, the reader will be accompanied by Wankel s Princess, who shall lead us through Moravia in the sixth century BC as well as through her own life. Wankel s Princes is the authentic find of a female skeleton from the Entrance Hall of Býčí skála, whose skull Heinrich Wankel kept for himself for unknown reasons and never sold it with the rest of his collection. This chapter presents the latest knowledge regarding the richest woman of her time in Moravia, a noblewoman with golden earrings/ hair bands, which are nowadays still mistakenly described as diadems. Hein rich Wankel himself did not use this find for his final interpretation of the Entrance Hall situation - he attributed the leitmotif of the whole situation to a nobleman burial (Fig. 46). The preserved skull has served as the basis of two model reconstructions of this woman s face, one in 2D and one in 3D form (Fig. 47). Another step is the attempt to reconstruct this woman s dress (Fig. 48), based on Hallstatt iconographie sources, direct textile evidence and our knowledge of textile production. This is followed by illustrations of the probable stages of her life and her position as a princess - a child/girl and a woman/wife, the role of her husband is also outlined. The authors identify Brno as the locality of her origins. The story of the life of this
noblewoman is concluded in the conceptualization of her death (either natural or untimely) and her archeologically documented burial in the Entrance Hall of Býčí skála (Fig. 49). The authors also present the various forms of death and manipulation of bodies buried in the Entrance Hall according to the anthropological study of skulls deposited in the Vienna museum. The story of Wankel s Princess ends with a tale of The Blacksmith and the Devil, dated approximately 6,000 years back and carrying forth a wonderful message from the depths of European prehistoric times. The topic of smithy is not selected at random, since it was in the Hallstatt sanctuary in Býčí skála where many artefacts of craft production were discovered (Fig. 50).
REJSTŘÍK A Absolon, Karel, archeolog: 26, 56, 84, 85, 86, 92, 203 aktuální role boha: 171-172 archeologie: 10, 12-16, 19, 20-28, 40, 45, 48, 55-59, 92, 93, 124, 142, 143, 158, 166-167, 205-207, 210, 216-217, 223, 229, 232 artefakt: 21-22, 25, 36, 38, 40, 42, 47, 49, 61-62, 72, 88, 91, 93, 95, 96, 103, 107, 112, 123, 125, 130-136, 143, 158, 166-169, 175, 182, 202, 207-209, 229-230 antropologie: 138, 156, 210-211 apis: 195 astrální larva: 186-187 В baroko: 24, 48, 56, 66-67, 80-81, 90-91, 168 bohyně: 66, 124, 160-161, 192, 195, 218 božstvo: 129, 172, 173, 180, 188, 193-195, 198 Boskovicko: 34, 35 bronz: 96, 110, 111, 130, 132 bronzová nádoba: 98, 116, 118, 223, 227 brousek: 133, 135 Brněnsko: 35, 36, 74, 111, 117, 120, 121, 215, 222 bůh: 79, 124, 152, 171-174, 186, 192, 195 C cesta (komunikace): 10, 22, 23, 48, 49, 50-54, 62, 64, 114, 121, 132, 134, 164, 165 Č čas: 9, 10, 11, 14-17, 19, 21, 22, 23, 31, 34, 37, 38, 40, 41, 47, 53, 54, 61, 69, 90-92, 112, 118, 143, 144, 146, 148, 149, 152, 154, 159, 174, 176-179, 180, 184, 190, 192, 195, 199-201, 206-208, 209, 215, 229, 233 člověk: 10, 14, 16, 18-22, 24, 29, 32, 33, 35, 37, 40-42, 54, 57, 61-62, 64-66, 91-92, 104, 117, 123-125, 143, 146-149, 152, 155, 165-169, 171-174, 176, 179, 181-182, 184-186, 189, 201, 205, 209, 214, 216,223-225, 228-229 Čechy: 24, 28, 50, 52-53, 85, 90, 97, 141, 187, 191, 193, 194, 196, 230 D depot: 78, 89, 94, 121, 125-127, 131, 180, 184 démon: 171, 172, 174, 177, 179, 182, 188, 194, 195, 232, 234 dílna: 79, 90, 95, 97, 110-111, 139 dítě: 129, 158, 168, 214-217 dívka: 123, 204, 215-217, 227 dláto: 97, 100
doba bronzová: 48, 56, 66, 75-76, 90, 123, 130, 179, 197, 222, 230, 232 doba halštatská: 12, 23, 28, 38, 43, 44, 75-77, 91, 93, 94, 102-103, 105-107, 109, 112, 114, 115, 120, 123-125, 129, 130, 132, 137, 138, 140, 142, 152, 197, 205, 212, 213, 219, 222 doba laténská: 56, 77, 90, 122, 125, 131, 141, 142 doba římská: 56, 77-78, 90 doba stěhování národů: 56, 78, 90 Drahanská vrchovina: 10, 14, 16, 26-27, 33-39, 43-44, 48, 50-53, 64, 71, 74, 79, 92, 93-94, 104, 111- 115, 121, 132, 134, 143, 154, 180, 216 druhá republika: 56, 85, 90 druhá světová válka: 43, 56, 63, 85-86, 89, 106, 150, 164, 165, 188 duch: 176, 191, 197, 200 dům: 10, 13, 19, 20, 22, 32, 35-37, 42-44, 48, 62-63, 76, 107-113, 127, 183, 233, 234 dvorec: 108, 139 dýka: 98, 116, 118, 221 E egregor: 174-175, 183, 187, 200 ekofakt: 22, 62, 96 elementál: 187 elita: 103, 139, 165 eneolit: 56, 73-74, 90-91, 152, 157-159
etnografie: 25, 124, 158 etnologie: 143, 166-167, 175, 182, 185, 191, 200, 208 F figurka (plastika): 98, 99, 195 forma (na odlévání): 111, 133, 134 funkce (praktická): 42-44, 48-49, 90-91, 131 C geologie: 28, 55 graffiti: 48, 64, 66, 143, 163, 165 H Ha CI (C1a-C2b): 93 Ha C2 (C2a-C2b): 93, 117, 118, 223 Ha D1 (D1a-D2b): 93, 103, 117, 118, 139, 223 Ha D2 (D2a-D2b): 93, 103, 118, 140 Ha D3: 93, 103 helma: 98, 118 hradiště: 37, 38, 44, 78, 94, 112-113, 127, 134, 139 hrob: 97, 112-119, 121, 122, 124-125, 127-129, 139, 182-184, 212-213, 216, 220-223, 232 hutník a hutnictví: 38, 97, 101 Ch chlapec: 123, 215 chronologie: 164 Jáchymka, jeskyně: 43, 71-72, 81, 90, 153, 164, 184 jantar: 36, 96, 110, 111, 132, 137, 139, 231 Jantarová stezka: 51, 53, 77, 139, 141, 196 jeskyně horizontální: 29, 62, 107 jeskyně vertikální (též propast):29, 62, 107 Jižní odbočka: 57, 64, 69, 70, 71, 73, 77, 79, 88, 153, 168 К kamenný dům: 10, 22, 42, 44, 54, 63, 76, 103, 107, 183 kámen: 23, 36, 43, 59, 61, 66, 67, 69, 90, 94, 96, 124, 130-132, 135, 137, 162, 170, 183, 199 kardiofylax: 120, 121 Keltové: 77, 122, 131, 141-142, 195, 224 keramika: 35, 71-73, 75, 77-79, 81, 95, 106, 116, 152, 157, 159 kladivo: 97, 100, 101, 165, 232, 234 kovadlina: 100 klasicismus: 39, 56, 81, 90 kleště: 97, 100 kolonizace: 35-39, 68, 79 komorový hrob: 111, 117, 118, 127 komunikace (cesta): 38, 44, 49, 51-54, 64, 92, 121, 179 komunita: 15, 38, 83, 92, 93, 104, 111, 113, 114, 120, 116, 121, 123-127, 130, 136, 137, 154, 215, 222, 230 koňský postroj (a jeho části): 98, 101, 116, 118 korálek/korál (ozdoba): 66, 72, 99, 111, 116,
126, 133, 135, 202, 221 kopí: 98, 116-118 kost: 57, 66, 69, 74, 77, 95, 96, 106, 117, 158, 181, 193, 222, 223 kostra: 57, 109, 117, 120, 202, 204, 216, 221, 222 kost (nástroj): 96, 231 kovář: 13, 230-234 kovárna: 43, 95, 97, 102, 209, 230, 231, 234 krajina: 19-22, 25, 32-37, 40, 45, 47, 74-75, 84, 92-93, 112, 124, 144-148, 155-156, 164, 185, 197, 199-201, 228-229 kresba: 24, 73-74, 79, 82, 90, 157159, 161-162, 168 Krumlovský les: 130, 131, 135, 155 Kříž, Martin, archeolog: 12, 56, 65, 72, 84 Křtiny, poutní místo: 39, 44, 53, 79, 81, 152, 194 kněžka: 215-219 kněžna: 204, 215 kult: 116, 153-154, 171, 173-176, 182-184, 188, 189, 192-195, 197, 222 kultura (halštatská): 139-142 kultura (laténská): 77, 142 Kuřimsko: 34-36 Kůlna, jeskyně: 62, 91-92, 150 kůň: 69, 116-117, 139, 167, 180, 185, 193, 203 L lebka: 95, 103, 117, 122-125, 183-184, 202-204, 209-211, 213, 216, 220, 222,227 Lichtenštejnové: 39, 81-83, 89, 94, 204
M mapa (plán): 10, 24, 57, 84, 95, 160, 168,205 matka: 20, 73, 84, 90, 192, 215-216, 222,224-225 mezolit: 56, 70-71, 90, 130 měsíc: 32, 50, 69, 87, 181 Měsíc: 63, 176, 198, 209 model (společenský): 34, 38, 44, 83, 89, 94, 106, 215 Morava: 9-Ю, 24, 26, 35, 50-51, 56, 73, 76-78, 85, 90, 93, 103, 108, 111, 113, 118, 120, 123, 125-126, 137-138, 140-142, 160-162, 184, 187, 196, 204, 211-212 Moravský kras: 9-10, 16, 18, 24-25, 37, 53-54, 59, 64, 67, 71, 75-76, 78-79, 84, 87-89, 92, 107, 134, 144-146, 149-150, 152, 155-156, 164, 167, 180, 196-197 muž: 96-97, 116, 118, 120, 122, 126, 163, 198, 202-203, 220-222, 225-226, 220-222, 227, 230, 233 muž-velmož: 98, 117, 119 mýtus: 66, 145, 156, 168, 176, 180, 228-229 IM nabídka (opak odpovědi): 32-33 nadkomumtní areál: 38, 44, 83, 89, 93, 107, 113-114 náboženství: 22, 170-176, 182, 185֊ 186, 191, 194-195, 198, 224 náboženský: 42, 91, 130, 138, 152153, 173, 175-176, 177, 180, 183, 185, 188, 194-195, 196, 200, 219 náčelnictví: 138 •nástroj: 15, 50, 69, 90-91, 97, 100, 130, 135, 200, 219, 232 náušnice: 99, 116, 122, 212, 221, 223, 227 návštěva: 18, 20-21, 29, 37, 40, 43, 62, 82-83, 85, 136, 144-146, 150, 165, 190, 219 nebe: 20, 41-42, 176-178, 183, 192, 234 nebesa: 177, 180 nedávná minulost: 17, 56, 87-91, 141 Nekvasil, Jindra, archeolog: 12, 28, 56-57, 93, 126-127, 206 neolit: 37, 56, 59, 66, 71-72, 74, 90, 157, 159 nevěsta: 215 nížina (rovina): 33-34, 51, 113 nůž: 78, 98-99, 116-117, 131, 192 O oběť: 104, 124-125, 129, 153-154, 184, 189, 192-193, 195-196, 198, 220,223-227 obětní: 62, 91, 103, 127, 153, 179, 186, 188, 224 obětiště: 102-103,
108, 180, 185, 188, 195 obloha: 66, 127-129 obývání: 38, 40, 43, 80, 90, 103, 107 odpověď (opak nabídky): 32-33 Oliva, Martin, archeolog: 9, 69, 130, 225 oltář: 95, 122, 132-133, 180, 185, 202, 204, 221 onen svět: 41-42, 131, 182-184, 220-227 opasek: 98-99, 111, 116-117, 119122, 202, 212, 220-221 osídlení: 40-41, 89, 130, 139, 144 p paleolit: 10, 53, 55, 56, 69-70, 86, 89, 90-92, 144, 161, 187 palimpsest: 45-46, 48, 164, 185 Panonsko-labská stezka: 52-53 paroh: 101 Parzinger, Hermann, archeolog: 93, 107, 136 pastevectví: 13-14, 34, 112 Pekárna, jeskyně: 62, 91-92, 107, 152 peklo: 178, 183, 232, 234 písmo: 45, 157, 159-164, 166, 169 plsť: 212 podzemí: 13, 16-21, 24, 31, 37, 41-44, 59, 61, 63-67, 70-71, 76, 78, 80, 102, 125, 129, 153, 177-178, 191, 193, 196 podsvětí: 177, 184, 195, 232 pohádka: 228-232 pohřeb: 17, 76, 78, 89, 94, 97, 102, 104, 106, 113, 115, 117-119, 124-125, 129, 136, 140, 152, 180, 182, 184, 187-189, 191, 202-203, 205, 209, 215-216, 220-227 pohřebiště: 43-44, 94-95, 102-104, 106, 108, 113-118, 122-123, 127-129, 179, 215-216, 220-223, 226-227 pohřební ritus: 222-225, 227 polotovar: 38, 97, 100-101, 231 posednutí: 187 pouť: 152-156, 179
poutník: 13, 24, 41, 143, 147, 152, 154-155 pověst: 145, 155, 191-192 posvátno: 170-174 pódium: 23, 33, 45, 54, 143, 144, 148, 198 praktická funkce jeskyně: 40, 43-44, 90-91 profil: 60, 92, 106, 139 Prostějovsko: 34-36, 51, 53, 74, 77 první republika: 56, 85, 90 prsten: 116, 120, 122, 202-204, 212, 221 Předsíň (Býčí skály): 24, 27-28, 36, 43, 57-58, 60, 62-65, 68, 71, 74, 7677, 81-82, 84-86, 88, 90, 93-105, 132-133, 145, 153, 189, 202, 205, 216, 220-221, 223, 227, 231 přechodový rituál: 115, 170, 182, 215-218 přídavný pohřeb: 117, 119-220, 222-224 přírodnina: 96 přírodní národy: 166, 169, 173, 179, 198 půda: 20, 35-36, 66, 106, 111-112, 123, 129, 200 R radiouhlíková metoda: 106, 157 radiouhlíkové datování: 73, 77 Rakousko-Uhersko: 56, 83-84 rekonstrukce: 13, 22-23, 82, 88, 110, 116, 119, 128, 156, 167, 173, 194-195, 202, 206, 208-214 religionistika: 156 renesance: 56, 79-80, 90 rituál: 72, 74, 76, 115, 147, 152-153, 170-171, 176, 180, 186, 189-183, 186, 188, 198, 208, 215-219, 223-225, 227, 232 rohovec: 69, 72, 92, 130, 135, 155 romantismus: 25, 56, 81-83 romantické úpravy: 48 rondel: 94, 128-129, 216 rondeloid: 94, 112, 127 rovina (nížina): 36 rožeň: 116-117, 126 řemeslo: 101, 110, 146 S sediment: 12-13, 60, 71, 88, 92, 96, 106,135 sekera: 72, 78, 98, 116, 118 sekeromlat: 98 sídelní areál: 13, 20, 34-35, 37-38, 45, 108, 115, 127, 130 sídliště: 69, 77, 94, 108, 110, 113, 118, 123, 127, 144 síť sociální: 20, 200 skládaný opasek: 99, 119-120, 202, 221 sklo: 96, 132 Skutil, Josef, archeolog: 26 Skyt: 140-141, 167, 180, 185, 206 skytský: 186 Slovensko: 53, 73, 107, 114, 141,
183, 190-194, 196 slunce: 179, 181, 198, 229 Slunce: 63, 68, 128-129, 153, 161, 176-179, 198, 200 smrt: 20, 32, 65, 74, 104, 107, 124, 126, 129, 159, 168, 176, 182, 184-192, 195-196, 198-199, 203, 205, 218219, 220, 223, 225, 228, 230, 234 socialismus: 56, 87, 91 sociální fakt: 170-176, 190, 194 současnost: 10, 12, 22-23, 27, 38, 47, 49, 55, 56, 61, 87-91, 112, 144, 183, 194, 205, 206, 208 speleolog: 14, 30, 41, 62-63, 43, 84-85, 144, 148 speleologie: 16, 26, 29-20, 38, 55, 88, 90-91, 144, 147, 175 speleoarcheologie: 16, 23, 26, 30, 33, 42, 54, 59, 93 společenský význam: 42-44, 103, 113, 131 společnost: 31, 42, 48, 94, 115, 122, 124, 128, 131, 138-139, 142, 147, 149, 152, 154, 166-168, 170, 173, 175-176, 181, 204-205, 214-215, 217, 219-220, 228-229 svatyně: 42, 44, 71-72, 79, 89-90, 94, 101-103, 105-107, 109-112, 114, 116-118, 128, 131, 136-137, 145, 152, 155, 161, 178-181, 184, 193, 197, 199-201, 206, 216, 227 Stloukal, Milan, antropolog: 56, 97, 103-104, 123, 211, 221 stratigrafie: 59-61 středověk raný: 35, 37-38, 56, 78, 90 středověk pozdní: 48, 56, 79 středověk vrcholný: 33, 38-39, 56, 79, 90-91 symbol: 97, 129, 160-161, 165, 168-169, 171, 176-177, 188, 196, 198-199 symbolický smysl: 42, 44, 67, 131, 152
š šperk: 9, 51, 57, 97, 106, 115, 122, 126, 153, 202, 204-205, 212-213, 216, 220-221, 223, 225 T tabu: 89, 174, 176, 179, 184-185 textil: 96, 120, 137, 212-213, 218, 226, 231 těžba: 48, 72, 90, 113, 130-131, 155, 191, 198 tkaní: 213-214, 217-218 tkalcovský stav: 132, 214 tkalcovské závaží: 133-134, 212 tramp: 40, 85-86, 148 tramping: 38, 90-91, 147 třetí republika: 56, 87, 91 turista: 24, 41, 43, 48, 64, 81-82, 84 turismus: 38, 90-91, 147 typologie: 59-60 V vědec: 9, 11, 13-15, 17, 28-30, 41, 55, 84, 92, 156, 206, 214, 229 vesnice: 20, 22, 27, 37, 46, 48, 50, 108, 112-113, 183, 193 velmož (muž-velmož): 17, 76, 98, 102, 113, 115-117, 118-119, 138-140, 204, 223, 219 velmožka (žena-velmožka): 76, 95, 99, 102, 111, 115-117, 119-121, 132, 139, 220-224 vchod (do jeskyně): 11, 21, 62-63, 68, 85-86 voda: 35, 37, 41, 59, 63-67, 70, 81, 161, 190, 201 voják: 86, 143, 147, 149-151 votivni: 23, 77, 90-91, 103, 118, 127, 153 vótum: 121 Vranov u Brna, poutní místo: 24, 34, 44, 79-81, 152 vrchovina: 10, 14, 16, 26-27, 33-40, 44, 48, 51-53, 64, 71, 74, 79, 92-94, 97, 104, 108, 111-115, 121, 132, 136, 143, 154, 180, 216 vůz: 54, 95, 97, 115, 118-119, 139, 184, 202, 221 Vyškovsko: 34-36, 53, 74, 121 Výpustek, jeskyně: 62, 66, 71-73, 81, 90-91, 146, 150-153, 161, 184, 188 výroba: 35, 43-44, 69, 85-86, 90-91, 97, 102-103, 110-111, 117, 120, 131, 135-136, 150, 197-198, 212, 231 výzkum: 12, 14, 16, 27, 50, 58-59, 61, 83-85, 89-91, 94, 97, 105, 115, 120, 130, 136, 143-144, 156, 163-164, 166, 169, 177, 180, 183, 188, 191, 193, 200, 202, 204, 207, 221-222, 230 vzduch: 63, 65, 176 W Wankel, Heinrich,
archeolog: 9, 12, 24-26, 55-58, 71, 76, 84, 88, 90, 94-95, 97, 103-106, 118, 122-123, 132, 136, 180, 182, 187, 202-205, 211, 218, 220 Wankelova princezna (též jen princezna): 95, 122, 202-227 Z záhrobí: 116, 183 závěsek: 135 zaušnice: 99, 116, 122, 212, 220-221, 223,227 zbraň: 51, 115-117, 197, 206, 225 země: 10, 41-42, 47-48, 66, 68, 82, 104-105, 108, 120, 125, 129, 131-132, 141, 176-178, 181, 183, 201, 225, 233 zemědělství: 159, 217 zlato: 96, 122, 176, 204, 218, 220֊ 221, 233 znak: 59, 89, 124, 138, 142, 146, 148, 157, 159-163, 166, 168, 210 zrnotěrka: 124-125, 132-134 Ž žároviště: 95-97, 103, 118, 154, 187, 202, 221 železo: 26, 36-37, 79, 96-97, 110-111, 113, 130-131, 136-137, 196-198 žena: 96-97, 104, 106, 111, 116, 121122, 128-129, 192, 198, 211-212, 215, 217-221-223 žena-velmožka: 76, 95, 99, 102, 111, 115-117, 119-121, 132, 139, 220-224 žezlo: 98-99
|
| any_adam_object | 1 |
| author | Golec, Martin 1975- |
| author_GND | (DE-588)1205552987 |
| author_facet | Golec, Martin 1975- |
| author_role | aut |
| author_sort | Golec, Martin 1975- |
| author_variant | m g mg |
| building | Verbundindex |
| bvnumber | BV046448999 |
| ctrlnum | (OCoLC)1142790914 (DE-599)BVBBV046448999 |
| edition | Vydání první |
| era | Geschichte gnd |
| era_facet | Geschichte |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>03348nam a2200649 c 4500</leader><controlfield tag="001">BV046448999</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20201222 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">200228s2019 a||| |||| 00||| cze d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9788074224201</subfield><subfield code="9">978-80-7422-420-1</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1142790914</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV046448999</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">cze</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">OST</subfield><subfield code="q">DE-12</subfield><subfield code="2">fid</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Golec, Martin</subfield><subfield code="d">1975-</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1205552987</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Fenomén Býčí skála</subfield><subfield code="b">krajina, jeskyně a člověk = The phenomenon of Býčí skála cave : lanscape, cave and mankind</subfield><subfield code="c">Martin Golec</subfield></datafield><datafield tag="246" ind1="1" ind2="1"><subfield code="a">The phenomenon of Býčí skála cave</subfield></datafield><datafield tag="250" ind1=" " ind2=" "><subfield code="a">Vydání první</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Praha</subfield><subfield code="b">NLN, s.r.o.</subfield><subfield code="c">2019</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">262 Seiten</subfield><subfield code="b">Illustrationen, Karten, Pläne</subfield><subfield code="c">24 cm</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="0" ind2=" "><subfield code="a">Archeologica</subfield></datafield><datafield tag="546" ind1=" " ind2=" "><subfield code="a">Zusammenfassung in englischer Sprache</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Höhle</subfield><subfield code="0">(DE-588)4025362-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Kultstätte</subfield><subfield code="0">(DE-588)4033541-0</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Hallstattkultur</subfield><subfield code="0">(DE-588)4072254-5</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Mähren</subfield><subfield code="0">(DE-588)4074432-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Böhmische Länder</subfield><subfield code="0">(DE-588)4069573-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Tschechien</subfield><subfield code="0">(DE-588)4303381-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Býči-skála-Höhle</subfield><subfield code="0">(DE-588)4395724-9</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="688" ind1=" " ind2="7"><subfield code="a">Hallstattzeit</subfield><subfield code="0">(DE-2581)TH000003382</subfield><subfield code="2">gbd</subfield></datafield><datafield tag="688" ind1=" " ind2="7"><subfield code="a">Tschechien</subfield><subfield code="0">(DE-2581)TH000012145</subfield><subfield code="2">gbd</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Tschechien</subfield><subfield code="0">(DE-588)4303381-7</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Böhmische Länder</subfield><subfield code="0">(DE-588)4069573-6</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Mähren</subfield><subfield code="0">(DE-588)4074432-2</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Hallstattkultur</subfield><subfield code="0">(DE-588)4072254-5</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="4"><subfield code="a">Höhle</subfield><subfield code="0">(DE-588)4025362-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="5"><subfield code="a">Kultstätte</subfield><subfield code="0">(DE-588)4033541-0</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="6"><subfield code="a">Býči-skála-Höhle</subfield><subfield code="0">(DE-588)4395724-9</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="7"><subfield code="a">Geschichte</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 25 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031860979&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 25 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031860979&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Literaturverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 25 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031860979&sequence=000005&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Abstract</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 25 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031860979&sequence=000007&line_number=0004&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Register // Gemischte Register</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">oe</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">gbd</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">BSB_NED_20200313</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">gbd_4_2012</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-031860979</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">930.1</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09014</subfield><subfield code="g">4371</subfield></datafield></record></collection> |
| geographic | Mähren (DE-588)4074432-2 gnd Böhmische Länder (DE-588)4069573-6 gnd Tschechien (DE-588)4303381-7 gnd Býči-skála-Höhle (DE-588)4395724-9 gnd |
| geographic_facet | Mähren Böhmische Länder Tschechien Býči-skála-Höhle |
| id | DE-604.BV046448999 |
| illustrated | Illustrated |
| indexdate | 2024-07-10T08:44:53Z |
| institution | BVB |
| isbn | 9788074224201 |
| language | Czech |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-031860979 |
| oclc_num | 1142790914 |
| open_access_boolean | |
| owner | DE-12 |
| owner_facet | DE-12 |
| physical | 262 Seiten Illustrationen, Karten, Pläne 24 cm |
| psigel | BSB_NED_20200313 gbd_4_2012 |
| publishDate | 2019 |
| publishDateSearch | 2019 |
| publishDateSort | 2019 |
| publisher | NLN, s.r.o. |
| record_format | marc |
| series2 | Archeologica |
| spelling | Golec, Martin 1975- Verfasser (DE-588)1205552987 aut Fenomén Býčí skála krajina, jeskyně a člověk = The phenomenon of Býčí skála cave : lanscape, cave and mankind Martin Golec The phenomenon of Býčí skála cave Vydání první Praha NLN, s.r.o. 2019 262 Seiten Illustrationen, Karten, Pläne 24 cm txt rdacontent n rdamedia nc rdacarrier Archeologica Zusammenfassung in englischer Sprache Geschichte gnd rswk-swf Höhle (DE-588)4025362-4 gnd rswk-swf Kultstätte (DE-588)4033541-0 gnd rswk-swf Hallstattkultur (DE-588)4072254-5 gnd rswk-swf Mähren (DE-588)4074432-2 gnd rswk-swf Böhmische Länder (DE-588)4069573-6 gnd rswk-swf Tschechien (DE-588)4303381-7 gnd rswk-swf Býči-skála-Höhle (DE-588)4395724-9 gnd rswk-swf Hallstattzeit (DE-2581)TH000003382 gbd Tschechien (DE-2581)TH000012145 gbd Tschechien (DE-588)4303381-7 g Böhmische Länder (DE-588)4069573-6 g Mähren (DE-588)4074432-2 g Hallstattkultur (DE-588)4072254-5 s Höhle (DE-588)4025362-4 s Kultstätte (DE-588)4033541-0 s Býči-skála-Höhle (DE-588)4395724-9 g Geschichte z DE-604 Digitalisierung BSB München 25 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031860979&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis Digitalisierung BSB München 25 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031860979&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA Literaturverzeichnis Digitalisierung BSB München 25 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031860979&sequence=000005&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA Abstract Digitalisierung BSB München 25 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031860979&sequence=000007&line_number=0004&func_code=DB_RECORDS&service_type=MEDIA Register // Gemischte Register |
| spellingShingle | Golec, Martin 1975- Fenomén Býčí skála krajina, jeskyně a člověk = The phenomenon of Býčí skála cave : lanscape, cave and mankind Höhle (DE-588)4025362-4 gnd Kultstätte (DE-588)4033541-0 gnd Hallstattkultur (DE-588)4072254-5 gnd |
| subject_GND | (DE-588)4025362-4 (DE-588)4033541-0 (DE-588)4072254-5 (DE-588)4074432-2 (DE-588)4069573-6 (DE-588)4303381-7 (DE-588)4395724-9 |
| title | Fenomén Býčí skála krajina, jeskyně a člověk = The phenomenon of Býčí skála cave : lanscape, cave and mankind |
| title_alt | The phenomenon of Býčí skála cave |
| title_auth | Fenomén Býčí skála krajina, jeskyně a člověk = The phenomenon of Býčí skála cave : lanscape, cave and mankind |
| title_exact_search | Fenomén Býčí skála krajina, jeskyně a člověk = The phenomenon of Býčí skála cave : lanscape, cave and mankind |
| title_full | Fenomén Býčí skála krajina, jeskyně a člověk = The phenomenon of Býčí skála cave : lanscape, cave and mankind Martin Golec |
| title_fullStr | Fenomén Býčí skála krajina, jeskyně a člověk = The phenomenon of Býčí skála cave : lanscape, cave and mankind Martin Golec |
| title_full_unstemmed | Fenomén Býčí skála krajina, jeskyně a člověk = The phenomenon of Býčí skála cave : lanscape, cave and mankind Martin Golec |
| title_short | Fenomén Býčí skála |
| title_sort | fenomen byci skala krajina jeskyne a clovek the phenomenon of byci skala cave lanscape cave and mankind |
| title_sub | krajina, jeskyně a člověk = The phenomenon of Býčí skála cave : lanscape, cave and mankind |
| topic | Höhle (DE-588)4025362-4 gnd Kultstätte (DE-588)4033541-0 gnd Hallstattkultur (DE-588)4072254-5 gnd |
| topic_facet | Höhle Kultstätte Hallstattkultur Mähren Böhmische Länder Tschechien Býči-skála-Höhle |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031860979&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031860979&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031860979&sequence=000005&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=031860979&sequence=000007&line_number=0004&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT golecmartin fenomenbyciskalakrajinajeskyneaclovekthephenomenonofbyciskalacavelanscapecaveandmankind AT golecmartin thephenomenonofbyciskalacave |