The Age of Aryamer: late Pahlavi Iran and its global entanglements
Gespeichert in:
Weitere Verfasser: | |
---|---|
Format: | Buch |
Sprache: | English |
Veröffentlicht: |
London
Gingko Library
2018
|
Schriftenreihe: | Gingko-St. Andrews series
|
Schlagworte: | |
Online-Zugang: | Inhaltsverzeichnis |
Beschreibung: | VII,289 Seiten Illustrationen |
ISBN: | 9781909942189 |
Internformat
MARC
LEADER | 00000nam a2200000 c 4500 | ||
---|---|---|---|
001 | BV045282002 | ||
003 | DE-604 | ||
005 | 20211122 | ||
007 | t | ||
008 | 181112s2018 a||| |||| 10||| eng d | ||
020 | |a 9781909942189 |c hardback |9 978-1-909942-18-9 | ||
035 | |a (OCoLC)1079405531 | ||
035 | |a (DE-599)BVBBV045282002 | ||
040 | |a DE-604 |b ger |e rda | ||
041 | 0 | |a eng | |
049 | |a DE-188 |a DE-12 |a DE-473 |a DE-703 | ||
084 | |a NQ 8820 |0 (DE-625)129080: |2 rvk | ||
245 | 1 | 0 | |a The Age of Aryamer |b late Pahlavi Iran and its global entanglements |c edited by Roham Alvandi |
264 | 1 | |a London |b Gingko Library |c 2018 | |
300 | |a VII,289 Seiten |b Illustrationen | ||
336 | |b txt |2 rdacontent | ||
337 | |b n |2 rdamedia | ||
338 | |b nc |2 rdacarrier | ||
490 | 0 | |a Gingko-St. Andrews series | |
600 | 0 | 7 | |a Mohammad Reza |c Iran, Schah |d 1919-1980 |0 (DE-588)118744569 |2 gnd |9 rswk-swf |
648 | 7 | |a Geschichte 1941-1979 |2 gnd |9 rswk-swf | |
651 | 7 | |a Iran |0 (DE-588)4027653-3 |2 gnd |9 rswk-swf | |
655 | 7 | |0 (DE-588)1071861417 |a Konferenzschrift |y 2016 |z London |2 gnd-content | |
689 | 0 | 0 | |a Mohammad Reza |c Iran, Schah |d 1919-1980 |0 (DE-588)118744569 |D p |
689 | 0 | 1 | |a Iran |0 (DE-588)4027653-3 |D g |
689 | 0 | 2 | |a Geschichte 1941-1979 |A z |
689 | 0 | |5 DE-604 | |
700 | 1 | |a Alvandi, Roham |d 1979- |0 (DE-588)1022349449 |4 edt | |
776 | 0 | 8 | |i Erscheint auch als |n Online-Ausgabe, ebk |z 978-1-909942-19-6 |
856 | 4 | 2 | |m Digitalisierung UB Bamberg - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030669538&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
999 | |a oai:aleph.bib-bvb.de:BVB01-030669538 | ||
942 | 1 | 1 | |c 909 |e 22/bsb |f 0904 |g 55 |
Datensatz im Suchindex
_version_ | 1804179056679190528 |
---|---|
adam_text | Contents Acknowledgements Introduction: Iran in the Age of Aryamehr Roham Alvandi 1 2 3 4 5 6 vii 1 Domesticating Cold War Economic Ideas: The Rise of Iranian Developmentalism in the 1950s and 1960s Ramin Nassehi 35 The Opium of the State: Local and Global Drug Prohibition in Iran, 1941-1979 Maziyar Ghiabi 70 Pahlavi Iran on the Global Stage: The Shah’s 1971 Persepolis Celebrations Robert Steele 110 A Cosmopolitan Dandy: Amir Abbas Hoveyda H. E. Chehabi 147 The Shiraz Festival and its Place in ban’s Revolutionary Mythology H. E. Chehabi 168 Nation Branding: The Prospect of Collecting Modem and Contemporary Art in Pahlavi Iran Samine Tabatabaei 202
7 ‘Anti-Imperialism of Fools’? The European Intellectual Left and The Iranian Revolution Claudia Castiglioni 8 Iran’s Global Long 1970s: An Empire Project, Civilisational Developmentalism, and the Crisis of the Global North Cyrus Schayegh Contributors
|
any_adam_object | 1 |
author2 | Alvandi, Roham 1979- |
author2_role | edt |
author2_variant | r a ra |
author_GND | (DE-588)1022349449 |
author_facet | Alvandi, Roham 1979- |
building | Verbundindex |
bvnumber | BV045282002 |
classification_rvk | NQ 8820 |
ctrlnum | (OCoLC)1079405531 (DE-599)BVBBV045282002 |
discipline | Geschichte |
era | Geschichte 1941-1979 gnd |
era_facet | Geschichte 1941-1979 |
format | Book |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01746nam a2200409 c 4500</leader><controlfield tag="001">BV045282002</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20211122 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">181112s2018 a||| |||| 10||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781909942189</subfield><subfield code="c">hardback</subfield><subfield code="9">978-1-909942-18-9</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1079405531</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV045282002</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-188</subfield><subfield code="a">DE-12</subfield><subfield code="a">DE-473</subfield><subfield code="a">DE-703</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">NQ 8820</subfield><subfield code="0">(DE-625)129080:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">The Age of Aryamer</subfield><subfield code="b">late Pahlavi Iran and its global entanglements</subfield><subfield code="c">edited by Roham Alvandi</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">London</subfield><subfield code="b">Gingko Library</subfield><subfield code="c">2018</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">VII,289 Seiten</subfield><subfield code="b">Illustrationen</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="0" ind2=" "><subfield code="a">Gingko-St. Andrews series</subfield></datafield><datafield tag="600" ind1="0" ind2="7"><subfield code="a">Mohammad Reza</subfield><subfield code="c">Iran, Schah</subfield><subfield code="d">1919-1980</subfield><subfield code="0">(DE-588)118744569</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte 1941-1979</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Iran</subfield><subfield code="0">(DE-588)4027653-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)1071861417</subfield><subfield code="a">Konferenzschrift</subfield><subfield code="y">2016</subfield><subfield code="z">London</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Mohammad Reza</subfield><subfield code="c">Iran, Schah</subfield><subfield code="d">1919-1980</subfield><subfield code="0">(DE-588)118744569</subfield><subfield code="D">p</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Iran</subfield><subfield code="0">(DE-588)4027653-3</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Geschichte 1941-1979</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Alvandi, Roham</subfield><subfield code="d">1979-</subfield><subfield code="0">(DE-588)1022349449</subfield><subfield code="4">edt</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Online-Ausgabe, ebk</subfield><subfield code="z">978-1-909942-19-6</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Bamberg - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030669538&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-030669538</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">909</subfield><subfield code="e">22/bsb</subfield><subfield code="f">0904</subfield><subfield code="g">55</subfield></datafield></record></collection> |
genre | (DE-588)1071861417 Konferenzschrift 2016 London gnd-content |
genre_facet | Konferenzschrift 2016 London |
geographic | Iran (DE-588)4027653-3 gnd |
geographic_facet | Iran |
id | DE-604.BV045282002 |
illustrated | Illustrated |
indexdate | 2024-07-10T08:13:48Z |
institution | BVB |
isbn | 9781909942189 |
language | English |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-030669538 |
oclc_num | 1079405531 |
open_access_boolean | |
owner | DE-188 DE-12 DE-473 DE-BY-UBG DE-703 |
owner_facet | DE-188 DE-12 DE-473 DE-BY-UBG DE-703 |
physical | VII,289 Seiten Illustrationen |
publishDate | 2018 |
publishDateSearch | 2018 |
publishDateSort | 2018 |
publisher | Gingko Library |
record_format | marc |
series2 | Gingko-St. Andrews series |
spelling | The Age of Aryamer late Pahlavi Iran and its global entanglements edited by Roham Alvandi London Gingko Library 2018 VII,289 Seiten Illustrationen txt rdacontent n rdamedia nc rdacarrier Gingko-St. Andrews series Mohammad Reza Iran, Schah 1919-1980 (DE-588)118744569 gnd rswk-swf Geschichte 1941-1979 gnd rswk-swf Iran (DE-588)4027653-3 gnd rswk-swf (DE-588)1071861417 Konferenzschrift 2016 London gnd-content Mohammad Reza Iran, Schah 1919-1980 (DE-588)118744569 p Iran (DE-588)4027653-3 g Geschichte 1941-1979 z DE-604 Alvandi, Roham 1979- (DE-588)1022349449 edt Erscheint auch als Online-Ausgabe, ebk 978-1-909942-19-6 Digitalisierung UB Bamberg - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030669538&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
spellingShingle | The Age of Aryamer late Pahlavi Iran and its global entanglements Mohammad Reza Iran, Schah 1919-1980 (DE-588)118744569 gnd |
subject_GND | (DE-588)118744569 (DE-588)4027653-3 (DE-588)1071861417 |
title | The Age of Aryamer late Pahlavi Iran and its global entanglements |
title_auth | The Age of Aryamer late Pahlavi Iran and its global entanglements |
title_exact_search | The Age of Aryamer late Pahlavi Iran and its global entanglements |
title_full | The Age of Aryamer late Pahlavi Iran and its global entanglements edited by Roham Alvandi |
title_fullStr | The Age of Aryamer late Pahlavi Iran and its global entanglements edited by Roham Alvandi |
title_full_unstemmed | The Age of Aryamer late Pahlavi Iran and its global entanglements edited by Roham Alvandi |
title_short | The Age of Aryamer |
title_sort | the age of aryamer late pahlavi iran and its global entanglements |
title_sub | late Pahlavi Iran and its global entanglements |
topic | Mohammad Reza Iran, Schah 1919-1980 (DE-588)118744569 gnd |
topic_facet | Mohammad Reza Iran, Schah 1919-1980 Iran Konferenzschrift 2016 London |
url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030669538&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
work_keys_str_mv | AT alvandiroham theageofaryamerlatepahlaviirananditsglobalentanglements |