Fayke newes: the media vs the mighty from Henry VIII to Donald Trump
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
Stroud, Gloucestershire
<<The>> History Press
2018
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | 353 Seiten Illustrationen |
| ISBN: | 9780750987783 |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV045071529 | ||
| 003 | DE-604 | ||
| 005 | 20190409 | ||
| 007 | t | ||
| 008 | 180702s2018 a||| |||| 00||| eng d | ||
| 020 | |a 9780750987783 |9 978-0-7509-8778-3 | ||
| 035 | |a (OCoLC)1045835285 | ||
| 035 | |a (DE-599)BVBBV045071529 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-706 |a DE-355 |a DE-11 |a DE-188 | ||
| 084 | |a NN 1300 |0 (DE-625)126530: |2 rvk | ||
| 084 | |a AP 16900 |0 (DE-625)6992: |2 rvk | ||
| 100 | 1 | |a Taylor, Derek J. |e Verfasser |0 (DE-588)1152978802 |4 aut | |
| 245 | 1 | 0 | |a Fayke newes |b the media vs the mighty from Henry VIII to Donald Trump |c Derek J. Taylor |
| 246 | 1 | 3 | |a Fake news |
| 264 | 1 | |a Stroud, Gloucestershire |b <<The>> History Press |c 2018 | |
| 300 | |a 353 Seiten |b Illustrationen | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 648 | 7 | |a Geschichte 1520-2018 |2 gnd |9 rswk-swf | |
| 650 | 0 | 7 | |a Falschmeldung |0 (DE-588)4294308-5 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Kommunikation |0 (DE-588)4031883-7 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Social Media |0 (DE-588)4639271-3 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Informationsgesellschaft |0 (DE-588)4114011-4 |2 gnd |9 rswk-swf |
| 689 | 0 | 0 | |a Kommunikation |0 (DE-588)4031883-7 |D s |
| 689 | 0 | 1 | |a Social Media |0 (DE-588)4639271-3 |D s |
| 689 | 0 | 2 | |a Informationsgesellschaft |0 (DE-588)4114011-4 |D s |
| 689 | 0 | 3 | |a Falschmeldung |0 (DE-588)4294308-5 |D s |
| 689 | 0 | 4 | |a Geschichte 1520-2018 |A z |
| 689 | 0 | |5 DE-604 | |
| 856 | 4 | 2 | |m Digitalisierung UB Regensburg - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030462727&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-030462727 | ||
Datensatz im Suchindex
| _version_ | 1804178679285153792 |
|---|---|
| adam_text | CONTENTS
1 The Tudors. Traitors and Heretics 5
2 Civil War and Oliver Cromwell. The Poisoner of the People 25
3 John Wilkes. The Terror of all Bad AMinisters 42
4 The American Revolution. Forge of Sedition 60
5 The Political Cartoon. Poking Fun 80
6 Nineteenth-Century Radicals. Guerrilla Journalism 99
7 The Crimean War. That Miserable Scribbler 117
8 The American Civil War. Wild Pavings 134
9 Suffragettes. The Truth fora Penny 150
10 The First World War. A Few Writing Chappies 171
11 The Press Barons. Mad, Bad and Dangerous 189
12 The Second World War. Bloody Marvellous! 209
13 TV News. The Idiot’s Lantern 227
14 The Soviet Union. Scruffy Dog-Eared and Undaunted 244
15 Vietnam. Bang-Bang and Body Bags 256
16 Watergate. Deep Throat and Dirty Tricks Til
17 The Falklands./l Quick Win for the Mighty) 297
18 Blair and Iraq. The Dodgy Spinners 309
19 The Social Media Revolution. TrumpyTu cets and Fake Mews 328
20 The Future. Wobbling On 346
Acknowledgements 354
Index 355
|
| any_adam_object | 1 |
| author | Taylor, Derek J. |
| author_GND | (DE-588)1152978802 |
| author_facet | Taylor, Derek J. |
| author_role | aut |
| author_sort | Taylor, Derek J. |
| author_variant | d j t dj djt |
| building | Verbundindex |
| bvnumber | BV045071529 |
| classification_rvk | NN 1300 AP 16900 |
| ctrlnum | (OCoLC)1045835285 (DE-599)BVBBV045071529 |
| discipline | Allgemeines Geschichte |
| era | Geschichte 1520-2018 gnd |
| era_facet | Geschichte 1520-2018 |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01813nam a2200433 c 4500</leader><controlfield tag="001">BV045071529</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20190409 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">180702s2018 a||| |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9780750987783</subfield><subfield code="9">978-0-7509-8778-3</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1045835285</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV045071529</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-706</subfield><subfield code="a">DE-355</subfield><subfield code="a">DE-11</subfield><subfield code="a">DE-188</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">NN 1300</subfield><subfield code="0">(DE-625)126530:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">AP 16900</subfield><subfield code="0">(DE-625)6992:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Taylor, Derek J.</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1152978802</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Fayke newes</subfield><subfield code="b">the media vs the mighty from Henry VIII to Donald Trump</subfield><subfield code="c">Derek J. Taylor</subfield></datafield><datafield tag="246" ind1="1" ind2="3"><subfield code="a">Fake news</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Stroud, Gloucestershire</subfield><subfield code="b"><<The>> History Press</subfield><subfield code="c">2018</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">353 Seiten</subfield><subfield code="b">Illustrationen</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte 1520-2018</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Falschmeldung</subfield><subfield code="0">(DE-588)4294308-5</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Kommunikation</subfield><subfield code="0">(DE-588)4031883-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Social Media</subfield><subfield code="0">(DE-588)4639271-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Informationsgesellschaft</subfield><subfield code="0">(DE-588)4114011-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Kommunikation</subfield><subfield code="0">(DE-588)4031883-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Social Media</subfield><subfield code="0">(DE-588)4639271-3</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Informationsgesellschaft</subfield><subfield code="0">(DE-588)4114011-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Falschmeldung</subfield><subfield code="0">(DE-588)4294308-5</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="4"><subfield code="a">Geschichte 1520-2018</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Regensburg - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030462727&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-030462727</subfield></datafield></record></collection> |
| id | DE-604.BV045071529 |
| illustrated | Illustrated |
| indexdate | 2024-07-10T08:07:48Z |
| institution | BVB |
| isbn | 9780750987783 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-030462727 |
| oclc_num | 1045835285 |
| open_access_boolean | |
| owner | DE-706 DE-355 DE-BY-UBR DE-11 DE-188 |
| owner_facet | DE-706 DE-355 DE-BY-UBR DE-11 DE-188 |
| physical | 353 Seiten Illustrationen |
| publishDate | 2018 |
| publishDateSearch | 2018 |
| publishDateSort | 2018 |
| publisher | <<The>> History Press |
| record_format | marc |
| spelling | Taylor, Derek J. Verfasser (DE-588)1152978802 aut Fayke newes the media vs the mighty from Henry VIII to Donald Trump Derek J. Taylor Fake news Stroud, Gloucestershire <<The>> History Press 2018 353 Seiten Illustrationen txt rdacontent n rdamedia nc rdacarrier Geschichte 1520-2018 gnd rswk-swf Falschmeldung (DE-588)4294308-5 gnd rswk-swf Kommunikation (DE-588)4031883-7 gnd rswk-swf Social Media (DE-588)4639271-3 gnd rswk-swf Informationsgesellschaft (DE-588)4114011-4 gnd rswk-swf Kommunikation (DE-588)4031883-7 s Social Media (DE-588)4639271-3 s Informationsgesellschaft (DE-588)4114011-4 s Falschmeldung (DE-588)4294308-5 s Geschichte 1520-2018 z DE-604 Digitalisierung UB Regensburg - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030462727&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Taylor, Derek J. Fayke newes the media vs the mighty from Henry VIII to Donald Trump Falschmeldung (DE-588)4294308-5 gnd Kommunikation (DE-588)4031883-7 gnd Social Media (DE-588)4639271-3 gnd Informationsgesellschaft (DE-588)4114011-4 gnd |
| subject_GND | (DE-588)4294308-5 (DE-588)4031883-7 (DE-588)4639271-3 (DE-588)4114011-4 |
| title | Fayke newes the media vs the mighty from Henry VIII to Donald Trump |
| title_alt | Fake news |
| title_auth | Fayke newes the media vs the mighty from Henry VIII to Donald Trump |
| title_exact_search | Fayke newes the media vs the mighty from Henry VIII to Donald Trump |
| title_full | Fayke newes the media vs the mighty from Henry VIII to Donald Trump Derek J. Taylor |
| title_fullStr | Fayke newes the media vs the mighty from Henry VIII to Donald Trump Derek J. Taylor |
| title_full_unstemmed | Fayke newes the media vs the mighty from Henry VIII to Donald Trump Derek J. Taylor |
| title_short | Fayke newes |
| title_sort | fayke newes the media vs the mighty from henry viii to donald trump |
| title_sub | the media vs the mighty from Henry VIII to Donald Trump |
| topic | Falschmeldung (DE-588)4294308-5 gnd Kommunikation (DE-588)4031883-7 gnd Social Media (DE-588)4639271-3 gnd Informationsgesellschaft (DE-588)4114011-4 gnd |
| topic_facet | Falschmeldung Kommunikation Social Media Informationsgesellschaft |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030462727&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT taylorderekj faykenewesthemediavsthemightyfromhenryviiitodonaldtrump AT taylorderekj fakenews |