Sistemi i ndëshkimeve në Shqipëri gjatë regjimit komunist: (1945-1990)
Saved in:
Main Author: | |
---|---|
Format: | Book |
Language: | Albanian |
Published: |
Tiranë
Dita 2000
2014
|
Subjects: | |
Online Access: | Inhaltsverzeichnis Abstract Literaturverzeichnis |
Physical Description: | 223 Seiten Illustrationen, Diagramme 24 cm |
ISBN: | 9789995692964 |
Staff View
MARC
LEADER | 00000nam a2200000 c 4500 | ||
---|---|---|---|
001 | BV044895010 | ||
003 | DE-604 | ||
005 | 20180410 | ||
007 | t | ||
008 | 180409s2014 a||| |||| 00||| alb d | ||
020 | |a 9789995692964 |9 978-99956-92-96-4 | ||
035 | |a (OCoLC)1031052346 | ||
035 | |a (DE-599)BVBBV044895010 | ||
040 | |a DE-604 |b ger |e rda | ||
041 | 0 | |a alb | |
049 | |a DE-12 | ||
084 | |a OST |q DE-12 |2 fid | ||
100 | 1 | |a Sufaj, Fehmi |e Verfasser |4 aut | |
245 | 1 | 0 | |a Sistemi i ndëshkimeve në Shqipëri gjatë regjimit komunist |b (1945-1990) |c Dr. Femi Sufaj |
264 | 1 | |a Tiranë |b Dita 2000 |c 2014 | |
300 | |a 223 Seiten |b Illustrationen, Diagramme |c 24 cm | ||
336 | |b txt |2 rdacontent | ||
337 | |b n |2 rdamedia | ||
338 | |b nc |2 rdacarrier | ||
648 | 7 | |a Geschichte 1944-1991 |2 gnd |9 rswk-swf | |
650 | 0 | 7 | |a Kommunismus |0 (DE-588)4031892-8 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Politischer Gefangener |0 (DE-588)4076230-0 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Strafrecht |0 (DE-588)4057795-8 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Arbeitslager |0 (DE-588)4002716-8 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Gefängnis |0 (DE-588)4071628-4 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Diktatur |0 (DE-588)4149920-7 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Todesstrafe |0 (DE-588)4060306-4 |2 gnd |9 rswk-swf |
651 | 7 | |a Albanien |0 (DE-588)4001028-4 |2 gnd |9 rswk-swf | |
689 | 0 | 0 | |a Albanien |0 (DE-588)4001028-4 |D g |
689 | 0 | 1 | |a Kommunismus |0 (DE-588)4031892-8 |D s |
689 | 0 | 2 | |a Diktatur |0 (DE-588)4149920-7 |D s |
689 | 0 | 3 | |a Strafrecht |0 (DE-588)4057795-8 |D s |
689 | 0 | 4 | |a Gefängnis |0 (DE-588)4071628-4 |D s |
689 | 0 | 5 | |a Arbeitslager |0 (DE-588)4002716-8 |D s |
689 | 0 | 6 | |a Todesstrafe |0 (DE-588)4060306-4 |D s |
689 | 0 | 7 | |a Politischer Gefangener |0 (DE-588)4076230-0 |D s |
689 | 0 | 8 | |a Geschichte 1944-1991 |A z |
689 | 0 | |5 DE-604 | |
856 | 4 | 2 | |m Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030288938&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
856 | 4 | 2 | |m Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030288938&sequence=000002&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |3 Abstract |
856 | 4 | 2 | |m Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030288938&sequence=000003&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA |3 Literaturverzeichnis |
940 | 1 | |n oe | |
942 | 1 | 1 | |c 909 |e 22/bsb |f 0904 |g 4965 |
942 | 1 | 1 | |c 340.09 |e 22/bsb |f 0904 |g 4965 |
943 | 1 | |a oai:aleph.bib-bvb.de:BVB01-030288938 |
Record in the Search Index
_version_ | 1806958308614995968 |
---|---|
adam_text |
PËRMBAJTJA E LËNDËS
PARATHËNIA .5
Vështrim historik mbi dënimet 1912-1944 .11
KREUIPARË
NGRITJA E SISTEMIT TË DREJTËSISË PENALE
GJATË VITEVE 1945-1952
1.1 Instalimi i shtetit komunist.47
1.2 Institucionet e sistemit të drejtësisë penale.60
1.3 Gjyqet politike spéciale.'.75
1.4 Krijmi i bazës ligjore të sistemit të drejtësisë.83
KREU I DYTË
SISTEMII DREJTËSISË GJATË PERIUDHËS 1952-1966
II. 1 Forcimi i luftës së klasave.91
11.2 Intensifikimi i përpjekjeve për rrëzimin e
regjimit komunist 1949-1953.101
11.3 Dënimet politike pas Konferencës së Tiranës (1956).115
11.4 II.4 Forcimi i karakterit represiv të kampeve dhe burgjeve.121
4
Dr. Femi Sufaj
KREU I TRETË
POLITIZIMII ORGANEVE TË DREJTËSISË 1966-1976
III. 1 Ashpërsimi i Situates politike në vend.149
111.2 Eliminimi i Ministrisë së Drejtësisë dhe mbrojtjes ligjore.151
111.3 Gjyqet kundër fesë dhe shkatërrimi i strukturës së besimit.158
111.4 Intemimet dhe dëbimet.163
KREU I KATËRT
ZHVILLIMET NË SISTEMIN E DREJTËSISË NËN
NDIKIMIN E KUSHTETUTËS SË VITIT 1976
IV. 1 Kushtetuta e vitit 1976- dëshmi e shkatërrimit të shtetit iigjor.173
IV.2 Kodi Penal i vitit 1977- instrument i luftës së klasave.178
IV.3 Kriza e sistemit të drejtësisë në vitet 1970-1980.181
Aneksi i dokumenteve.191
Konkluzione dhe rekomandime.207
Summary.213
Burime dokumentare dhe bibliografia
218
SUMMARY
The performance of institution for execution penal sentences was
direct mirror of policy-governance system during different time periods
of our history. Since the beginning of the last hundred years, when
Albania become part of the world political map as an independent and
sovereign country, after five centuries of Ottoman occupation, institutions
of penal sentences has changed drastically. There were changes on human
rights concept, their organization and architecture, treatment of inmates,
alternative of sentence, classification of them, the goals and vision of
prisons. During XX century, Albania passed some policy systems, as
monarchy in 1914, constitution monarchy in 1920-1924, and republican
system 1925-1928, constitution monarchy in 1928-1939, under occupation
of fascist 1939-1944, and dictatorship of communist from 1945-1991.
During 1912 to 1944 we can see some attributes of penitentiary system
in Albania, that are connection with others elements of macro system.
First of all, during this period, due to the low level of economical
developmentthere were very weak prisons infrastructure, with an inadequate
architecture which do not guaranteed security, human treatment, hygienic
conditions and possibility for future return to society of prisoners. During
the Second World War were opened many deportation camps as, Porto
Romanno, Burrel, and many were deported abroad. In that time the first
clients of prisons and camps were antifascists. It was estimated about 2500
prisoners and more than 2000 deportee in Albanian prisoners and camps in
1943.(in that time Albania has 1 million inhabitants).The general situation
of prisons during tfie War was described by Army General, G.Pagrili on
1942: “Civil prisons in Albania are placed at provisory locations, which
normally lack any hygienic and moral conditions, they are not appropriate
even on security level.In prisons there are mixed those with long and
life sentences, with those with soft sentences and waiting for trial. The
damage coming from this mixture is very clear and the prison fails to
214
Dr. Femi Sufaj
achieve its moral education of those convicted for severe crimes”.
Second: Up to enforcement of Zog regime for management and
organization of prison system, there were in force legal acts inherited from
Turkish regime. Penal law of April 28-th, 1910 in some parts organized
the prisons administration (acts 131-149).The establishment of Legal
framework started after 1920.
Third: We see human attitude toward dealing with prisoners. Through
series of documents, responsible structures were remarked on cases of
violations of prisoners rights and also for cases of maltreatments.
1. The period of executions and terror 1944-1952
This is the period of hardest terror and of the highest use of torture. The
first years of communist power were followed by an overall violence and
attack against all classes that were considered opposite to the communist
system, ’’exploiting classes”, traders, proprietary’s, intellectuals, workers
of previous administration, representatives of clergy. No one could escape
to this violence even most simple and power classes. The goal was total
submission of citizens and recruiting a labor force to work at most difficult
sectors, what could not be covered by free workers
Based in a report about criminality in Albania during 1945 — 1957
were proceeded and sentenced for ordinary and criminal crimes 109111
persons. This figure does not included crimes against the state, out of
which we do not have figures from 1944 — 1948,(it was the time when the
persons are executed without trial) while during 1948 — 1957 there were
about 4198 proceedings.
Crimes against the state from 1950 till 1957 , were processed 4918
persons,3578 were sent in the court,620 investigations were stopped.
During the years have been processed:
1950 1951 1952 1953 1954 1955 1956 1957 Total ï
846 1160 711 510 229 113 290 319 4198
Military crimes:1952-1957 were processed 1752 persons,1533 were
sent in the court,619 investigations were canceled. During the years have
been processed:
1952 1953 1954 1955 1956 1957 Total i
407 303 335 340 22 145 1752
Sistemi i ndeshkimeve ne Shqiperi gjate regjimit komunist
215
Ordinary crimes
From 1948 till 1957 were processed 77.709 cases and 60.735 of them
were sent to court. 16.874 investigations were canceled. This number
doesn’t include the cases which were investigated by the court or sent to
the court by the police.
In the cases referring to the years 1948 till 1957 ,103.035 persons
have been assumed and 80.365 have been sent to court. Referring to the
years:
1948 1949 1950 1951 1952 1953 1954 1955 1956 1957
14.000 21.000 21.045 14.784 10.088 6.653 4.592 4.241 3.263 3.365
2. Justice system during the period 1952-1966
Under the influence of the liberalization reforms after death of
Stalin and events of Hungary, in the so -called “socialist camp”, Albania
included, there has been a decrease of political condemnations and
internal exiles, and a reduction of the “War Classes, in general. However,
within this period there have been 93 executions. Measures were taken
for working camps were no more exterminating camps, but treatment of
detainees were out of international norms and standards: they slept on
cement floors, were beaten systematically as a disciplinary measure, the
food was insufficient.
3. Justice system under the pressure of Political party and ideology
1966-1976
During this period, trials and death penalties restarted declaring the
return to former methods of Stalinism. There have been 139 executions.
This period represents the total isolation of Albania also from Eastern
Europe and embracement of the Chinese model of totalitarianism.
According to this model, the most famous music and literature international
works, elements of the private ownerships, and especially the religion
rituals and faith were prohibited. On behalf of the so-called “New Man”,
a lot of interventions over the scholar education, the life style, the social
relationships, were done. Ministry of Justifce and Advocacy were closed.
In 1961 the prisoners are- accommodated in 6 work camps and 4 prisons.
This is the period where the amnesties for prisoners were reduced.
In November 1962, for the 50-years Anniversary of independence
there were given amnesty to 1211 ordinary prisoners and 144 political
216
Dr. Femi Sufaj
prisoners. In 1966, in Kirova it was established the first working camp
for women. The disgraceful conditions are evidenced as one room
available for 60 women.
This is the period against liberalism. The war of classes became
more powerful over the so-called “ideological front” This is the period of
superstructure hard attacks: arts, economy and army. The artists writers
and composers were attacked. A typical example of these art attacks was
the denunciation of the 11-th Festival of Radio and Television. At the
same time, members of the army and economy got death penalties and
serious condemnations. In 1973 the number of detained increase 28%.In
this period it is noticed an increase of the administrative condemnations,
which in essence was a Chinese model. The number of executions during
this time is 74.
4. New constitution and the crisis in the judiciary, 1976-1990
A year after the Constitution was adopted the new Criminal Code,
which sanctioned the criminal policy of the communist state in the spirit
of the new constitution and new circumstances in which the country
stands. Given its content and according to many scholars of penalogve
the criminal code of 1977, marking a regression compared to the 1952
Criminal Code. This seems to share the general concerns and principles to
further enlargement of the figures of crime punished with death and long
imprisonment.
After death of Hoxha, Alia followed the politics of continuity while
the country was facing extraordinary economical problems. The number
of executions during this period is 88.As a result of the increasing
suppression from events of other countries of Eastern Europe and the
catastrophic economical situation, the regime was obliged to allow some
democratic processes. Many people are killed in borders, trying to release
and moving in democratic countries.
During 1991 the infamous Space camps were closed, Qafe Bari,
Bulqiza, Burrel prison and for a short time closed all labor camps being
inherited only two prisons, the prison of Tirana Burrel and in a poor
condition and painful history. Democratic state with the generous assistance
of international organizations initiated deep reforms in all directions to
improve the prison service and respect for human rights and freedoms.
The reforms consisted in changing laws and regulations by harmonized
Sistemi i ndeshkimeve ne Shqiperi gjate regjimit komunist
217
European standards, the change of staff and training, the improvement of
conditions of treatment and social rehabilitation. From the beginning of
the democratic process until now we have an increase and improvement
of service unparalleled in the first prison in conception as a public service,
in respect of fundamental human rights, in connection with civil society,
expand capacity and improvement standards of treatment.
BURIME DOKUMENTÄRE DHE BIBLIOGRAFIA
I. Burime dokumentäre
. A. Permbledhje dokumentesh te botuara
Permbledhje e legjislacionit shqiptar,ne dy vellime, Tirane 1984
Evropa Lindore ne dokumentat kryesore ruse (1944-1953), vol.I
(1944-1948), Moske, 1997
Lauka, L, Imeri, E., Shqiperiane e dokumentave ruse,
Tirane,’Toena”,2006
Plasari,N.,Malltezi, L.,Politikae Enver Hoxhes,
Plenumi 12-te IKQ te PKSh, Tirane, 1996
B. Dokumente arkivore te pabotuara
Arkivi Qendror i Shtetit, fondi Bashkia Shkoder (347),viti 1914-1944
Arkivi Qendror i Shtetit, fondi Gjykata e shkalles pare Shkoder
(348),viti 1914-1944
Arkivi Qendror i Shtetit, fondi Prefektura Shkoder (346),viti 1914-
1944
- Arkivi Qendror i Shtetit, fondi Prefektura Elbasan (271),viti 1914-
1944
Arkivi Qendror i Shtetit, fondi Gjykata e shkalles pare Elbasan
(274),viti 1914-1944
Arkivi Qendror i Shtetit, fondi Gjykata e shkalles pare Tirane (381 ),viti
1914-1944
Arkivi Qendror i Shtetit, fondi prefektura Tirane (379),viti 1914-1944
- Arkivi Qendror i Shtetit, fondi Drejtoria e burgut Tirane (354),viti
1914-1944
Arkivi Qendror i Shtetit, Zyra e burgut Tirane (391),viti 1939-1944
Arkivi Qendror i Shtetit, Zyra e burgut Burrel (233),viti 1939-1944
Arkivi Qendror i Shtetit, Zyra e burgut Gjirokaster (294),viti 1920-
1944
Arkivi Qendror i Shtetit, Prefektura Dürres (235),viti 1921-1944
Sistemi i ndëshkimeve në Shqipëri gjatë regjimit komunist
219
Arkivi Qendror i Shtetit, Prefektura Gjirokastër (294),viti 1921-1944
Arkivi Qendror i Shtetit, Prefektura Korçë (317),viti 1917-1944
Arkivi Qendror i Shtetit, Parlamenti (146),viti 1921-1944
Arkivi Qendror i Shtetit, Këshilli i Naltë i Shtetit (147),viti 1921-1924
Arkivi Qendror i Shtetit, Kryeministria (149),viti 1921-1944
Arkivi Qendror i Shtetit, Ministri i Oborrit (150),viti 1928-1938
Arkivi Qendror i Shtetit, Komanda e xhandarmërisë (154),viti 1921-
1938
Arkivi Qendror i Shtetit, Ministria e Punëve të Brendshme (235),viti
1921-1944
Arkivi Qendror i Shtetit, Ministria e Drejtësisë(155),viti 1921-1944
Arkivi Qendror i Shtetit, Gjykata Politike (157),viti 1924-1925
Arkivi Qendror i Shtetit, Ministria e Arsimit (195),viti 1921-1944
Arkivi i Ministrisë së Punëve të Brendshme, Fondi Dega e Kampeve
dhe Burgjeve, dosjet 1-150, viti 1946-1974.
Arkivi i Drejtorisë së Përgjithshme të Burgjeve, viti 1981-1991
Arkivi Qendror i Shtetit, Fondi Arqipeshkëvia Durrës (131), v.1945-
1966
Arkivi Qendror i Shtetit, Fondi Këshilli Antifashist
Nacionalçlirimtar(489), v.1945
Arkivi Qendror i Shtetit, Fondi Këshilli Ministrave (490), v.1945-1981
Arkivi Qendror i Shtetit, Fondi Ministria e Drejtësisë (515), v.1945-
1966
Arkivi Qendror i Shtetit, Fondi Komiteti Mysliman (482), v.1946-
1966
Arkivi Qendror i Shtetit, Fondi Presidiumi i Kuvendit Popullor(489),
V. 1946-1991
Arkivi Qendror i Shtetit, Fondi Ministria e Ekonomisë (494), v.1946
Arkivi Qendror i Shtetit, Fondi Ministria e Punëve Botore, (499)
v.1946
Arkivi Qendror i Shtetit, Fondi Gjykata e Lartë Ushtarake(516),
v.1945-1960
Arkivi Qendror i Shtetit, Fondi Ministria e Financave(505), v.1949-
1968
Arkivi Qendror i Shtetit, Fondi Prokuroria e Përgjithshme(492),
v.1945-1991
Arkivi Qendror i Shtetit, Fondi Ministria e Ndërtimit(499), v.1952
220
Dr. Femi Sufaj
- Arkivi Qendror i Shtetit, Fondi Komiteti Bektashi(483), v.1954
Arkivi Qendror i Shtetit, Fondi Arqipeshkevia Shkodér (132), v.1955
Arkivi Qendror i Shtetit, Fondi Abacia e Mirdités(616), v.1955
Arkivi Qendror i Shtetit, Fondi Gjykata e Larté(493), v. 1945-1991
II. Literatura historiografike
1. Histori e popullit shqiptar, véll.III, Bot. Akademia e Shkencave, viti
1999
2. Histori e popullit shqiptar, véll.IV, Bot. Akademia e Shkencave, viti
1999
3. Historia e Shqipérisé, véll.IV, Bot. Akademia e Shkencave, viti 1983
4. Historia e Shqipérisé pér shkollat e mesme, Tirané, 1994, fq 232
5. Duka,V.- Historia e Shqipérisé 1912-2000, Tirané, 2007
6. Dervishi, K. -Historia e shtetit shqiptar 1912-2005, Tirané, 2006
7. Vllamasi, S. -Ballafaqime politike né Shqipéri 1897 - 1942. Tirané
2000
8. Norval Morris and David J. Rothmans. -The Oxford of the
Prison. The practice of punishment in éestrern Society. Bot I. New
York Oxford. Oxford Universitety Press, 1995.Bot II 1998.
9. Elezi, I. Zhvillimi Historik i Legjislac Penal né Shqipéri, Tirané,
Bot 1.1997
10. Elezi, I. E Drejta Zakonore e Labérisé né Planin Krahasues. Tirané,
1994
11. Bemard Fischer. Pérpjekjet e Mbretit Zog pér Stabilitet né Shqipéri.
Copyright 1984. Pérkthim.Qabej. Tirané
12. Bemd Fischer, Shqipéria 1943-1945,Njevéshtrim pérmes
dokumentave perendimore.AUS 2012
13. Pol Xhonson. Kohét Moderne. Bota nga vitet 1920-1990.Véllim I.
Pérkthyer nga Vjollca Shtylla. Copyright 1983
14. Sufaj, F. Histori e Burgjeve té Shqipérisé. Albín Tirané 2000
15. Krasniqi, A. Sistemetpolitike né Shqipéri 1912-2008. UFO Press,
Tirané 2009
16. Bemd J.Fischer, Shqipéria gjaté L Pérkth.
K.Hajdéri.Tirané: Qabej MQM, 2000
17. Dyrmishi, D.- Luftapolitike né udhéheqjen e PKSh (PPSh)1944-
1960,Tirané 2011
18. Doja, A. -Bektashizmi né Shqipéri. Histori politike e njé lévizje
fetare, Tirané 2008
Sistemi i ndeshkimeve ne Shqipéri gjate regjimit komunist
221
19. Edwin Jacques, Shqiptarét, Perkthyer nga Edi Seferi, Tirané, 2002
20. Mandela, N. -Rruga e gjaté drejt ¿irisé, Little Broen, Londer,1994.
Cituar prej Coyle, A.: Drejtimi i burgut nga kéndvéshtrimi i té
drejtave té njeriut, perkthyer nga Rudina Xhillari, Tirane: Grafon,
2005
21. Shkémbi,H.- Historia e Policisé, Tirane, 1996
22. Hoxha, E.- Titistét, Tirane, 1982
23. Kol.Dejvid Smaili, Me detyré né Shqipéri, Tirane 1993.
24. Roberto Moroco déla Roka, Kombi dhefeja né Shqipéri 1920-1944,
Pérktheu Luán Omari, Tirané
25. Pipa, A. Stalinizmi shqiptar, Tirané, “Pegi” 2007
26. Bare,Th.- Provokacione dhe komplote kundér Republikés Popullore
té Shqipérisé né vitet 1945-1956, Tirané 1966
27. Reginald Hibbert, Fitorja e hidhur.Lufta Nacional Clirimtare e
Shqipérisé, Pérkth. Xhevat Lloshi,Tirané 1993
28. Hannah ARENDT Origjina e TotalitäPérkthyer prej origjinali
nga Myñar Gjana Prishtiné 2002
29. Misja, V. ;Veisiu, Y. ;Bérxolli, A. - Populista e Shqipérisé,Tirané
1987
30. Nina D. Smimova, Historia e Shqipérisé pérgjaté shekullit XX,
Ideart, Tirané
31. Zavalani, Tajar -Historia e Shqipnis, Tirané, Bot. i 2-té, Phoenix,
1998
32. Elezi, Ismet; Hysi, Vasilika -Politika Kriminale, PEGI, Tirané 2006,
fq 64
III. Botime dhe artikuj né revista dhe gazeta
1. Stérmilli, Haki. Burgu Bot I. Viti 1935. Shtypshkronja Tirana.
2. Karl Menninger The Crime of Punishment. New York.The Viking
Press 1968
3. Gje^ovi, Shtjefen. Kanuni i Leké Dukagjinit. Pérmbledhje e kodifikuar.
Shtypshkronja Fran^eskane. Shkodér.1933
4. Leka, Gani. Shqipéria né dhe njémijé. Letrat. Tirané 2004. Pérkthim i
Indro Montanellit. Albania una mille.
5. Gashi, Rexhep. Ekzekutimi i dénimit me burgim né Shqipéri, Prishtiné
2001.
222
Dr. Femi Sufaj
6. At Zef Pllumbi,-^r«o vetem me tregue, Tirane, Shtepia bot. “55”, 2006
7. Repishti, S.-Nen hijen e Razafes,narrative e jetueme. Tirane, “Onufri”
2004
8. Musta, A. Burgjet e Diktatures Komuniste e
Shqiperise, Tirane, 2005
9. Musta, A.- Gjemat e komunizmit ne Tirane 2001
10. Imzot Zef Simoni, Persekutimi i katolike ne Shqiperi nga
1944-1990
11. Aliko, T.- Antologfia e krimit komunist, Tirane, 2006
12. Dosti, H.- Nje jete per ceshtjen Ko Tirane 2008
13. Koncilija, Ziga. Karakteristikat kryesore te sistemit juridik si mjet
represioni ne vitet 1945-1951 ne Slloveni. Kumtese mbajtur ne
Faenza, Itali ne Konferencen nderkombetare mbi stalinizmin dhe
viktimat e tij, me 27-29 shtator 2010.
14. Gullotta, Andrea. Kultura si rezistence: Rasti Ikampit te te
burgosurve Solovki. Kumtese mbajtur ne Faenza, Itali ne
Konferencen nderkombetare mbi stalinizmin dhe viktimat e tij, me
27-29 shtator 2010
15. Grbic, Srdjan. Nga denoncimi i Stalinit, nepraktikimin e Stalinizmit.
Kumtese mbajtur ne Faenza, Itali ne Konferencen nderkombetare
mbi stalinizmin dhe viktimat e tij, me 27-29 shtator 2010
16. Pol Xhonson Kohet Moderne. Bota nga vitet 1920 deri me 1990
.Vellimi I. Perkthyer nga Vjollca Shtylla. Copyright 1983 fq 20
17. Premtja, Sadik -Stalinizmidhe komunizmi ne Shqiperi. Botuar se
pari ne revisten “Intemacionalja e 4-t”, janar 1949 dhe ribotuar ne
revisten “Revolutionary History”, 1990
18. Blendi Fevziu, artikul \,Strategjiae terrorit gjate “mbreterimit” te
Enver Hoxhes, botuar ne Koha Jone, shtator 2011
19. Dyrmishi, Demir -Zgjedhjet e 2 dhjetorit, artikull i botuar ne “Tirana
Observer” 2 dhjetor 2005
20. Gazeta Zyrtare, nr. 12, date 22 maj 1945
21. Dyrmishi, Demir -Goditjet e organeve te drejtesise dhe denimi i Tuk
Jakoves dhe Bedri Spahiut (1949-1952),Stndime Historike, nr. 1-2,
viti 2007, botim i Institutit te Historise.
22. “iV embremjen e 17 nentorit”, botuar ne gazeten Shekulli, 16 prill
2011
23. Gazeta “Zeri i Popullit” date 3 mars 1951
24. Gazeta “Shekulli”, 6.8.2010
Sistemi i ndëshkimeve në Shqipëri gjatë regjimit komunist
223
25. Gashi, Rexhep -Zbatimi i vendimeve penale në Shqipëri, Prishtinë,
2001
26. Deklarata universale e të drejtave të njeriut. Miratuar nga Asambleja
e Përgjithshme me rezolutën e saj 217 A(III) të 10 dhjetorit 1948
27. Reviste e QShRT, Tiranë 2007
28. Dyrmishi, Demir - “ Spastrimii administratës shtetërore nga
kundërshtarëipolitikë(1944-1960). Revista Historike,nr 3-4, 2006
29. Jason Tomes, “ Takimete fshehta të Zogut me anglezët për të rrëzuar
Enver Hoxhëri”, artikull i publikuar në gazetën “Tirana Observer”, 23
tetor 2009
30. Vendimi u dhd\ artikull, botuar në “Zëri i Popullit”, datë 1 korrik 1950
31. Lalaj, Ana -1956- Pranvera e dështuar shqiptare, artikull, Revista
Historike, nr 4.V.2007
32. Gazeta “Korrieri”, datë 28.09.2008
33. Gazeta “Standard”, Shtator 2009.
34. At GARDINI, Dhjetë vjet burg në Shqipëri (1945-1955) Romë 1986.
Cituar prej Gazetës Shqip datë 4.3.2007
35. Gazeta “Zëri Popullit”, datë 9 janar 1980
36. Drejtësia Popullore nr, 1,1979
37. Gazeta “Tirana Observer” 10 gusht 2007
38. Gazeta “Panorama”, korrik 2009
IV. DISPOZITA LIGJORE
1. Kushtetuta e Republikës Popullore të Shqipërisë 1946.
2. Kushtetuta e Republikës Popullore Socialiste të Shqipërisë 1976.
3. Kodi Penal i Republikës Popullore të Shqipërisë 1952.
4. Kodi Procedurës Penale i Republikës Popullore të Shqipërisë 1953.
5. Kodi Penal i Republikës Popullore Socialiste të Shqipërisë 1977.
6. Ligji nr. 59 datë 17.5.1945 mbi organizimin e përkohshëm gjyqësor.
7. Ligji nr 275 datë 13.8.1946 mbi organizimin e përkohshëm gjyqësor.
8. Ligji nr. 1284 datë 9,6.1951 mbi organizimin e përkohshëm gjyqësor.
9. Udhëzim nr. 32 datë 11.1.1952 i Ministrisë së Brendshme për
administrimin e burgjeve.
10. Rregullore mbi Sigurimin dhe Riedukimin e të Dënuarve në Repartet
e Riedukimit e Burgjet 1986. |
any_adam_object | 1 |
author | Sufaj, Fehmi |
author_facet | Sufaj, Fehmi |
author_role | aut |
author_sort | Sufaj, Fehmi |
author_variant | f s fs |
building | Verbundindex |
bvnumber | BV044895010 |
ctrlnum | (OCoLC)1031052346 (DE-599)BVBBV044895010 |
era | Geschichte 1944-1991 gnd |
era_facet | Geschichte 1944-1991 |
format | Book |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>00000nam a2200000 c 4500</leader><controlfield tag="001">BV044895010</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20180410</controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">180409s2014 a||| |||| 00||| alb d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9789995692964</subfield><subfield code="9">978-99956-92-96-4</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1031052346</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV044895010</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">alb</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">OST</subfield><subfield code="q">DE-12</subfield><subfield code="2">fid</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Sufaj, Fehmi</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Sistemi i ndëshkimeve në Shqipëri gjatë regjimit komunist</subfield><subfield code="b">(1945-1990)</subfield><subfield code="c">Dr. Femi Sufaj</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Tiranë</subfield><subfield code="b">Dita 2000</subfield><subfield code="c">2014</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">223 Seiten</subfield><subfield code="b">Illustrationen, Diagramme</subfield><subfield code="c">24 cm</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte 1944-1991</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Kommunismus</subfield><subfield code="0">(DE-588)4031892-8</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Politischer Gefangener</subfield><subfield code="0">(DE-588)4076230-0</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Strafrecht</subfield><subfield code="0">(DE-588)4057795-8</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Arbeitslager</subfield><subfield code="0">(DE-588)4002716-8</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Gefängnis</subfield><subfield code="0">(DE-588)4071628-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Diktatur</subfield><subfield code="0">(DE-588)4149920-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Todesstrafe</subfield><subfield code="0">(DE-588)4060306-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Albanien</subfield><subfield code="0">(DE-588)4001028-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Albanien</subfield><subfield code="0">(DE-588)4001028-4</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Kommunismus</subfield><subfield code="0">(DE-588)4031892-8</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Diktatur</subfield><subfield code="0">(DE-588)4149920-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Strafrecht</subfield><subfield code="0">(DE-588)4057795-8</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="4"><subfield code="a">Gefängnis</subfield><subfield code="0">(DE-588)4071628-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="5"><subfield code="a">Arbeitslager</subfield><subfield code="0">(DE-588)4002716-8</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="6"><subfield code="a">Todesstrafe</subfield><subfield code="0">(DE-588)4060306-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="7"><subfield code="a">Politischer Gefangener</subfield><subfield code="0">(DE-588)4076230-0</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="8"><subfield code="a">Geschichte 1944-1991</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030288938&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030288938&sequence=000002&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Abstract</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030288938&sequence=000003&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Literaturverzeichnis</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">oe</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">909</subfield><subfield code="e">22/bsb</subfield><subfield code="f">0904</subfield><subfield code="g">4965</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">340.09</subfield><subfield code="e">22/bsb</subfield><subfield code="f">0904</subfield><subfield code="g">4965</subfield></datafield><datafield tag="943" ind1="1" ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-030288938</subfield></datafield></record></collection> |
geographic | Albanien (DE-588)4001028-4 gnd |
geographic_facet | Albanien |
id | DE-604.BV044895010 |
illustrated | Illustrated |
indexdate | 2024-08-10T00:28:49Z |
institution | BVB |
isbn | 9789995692964 |
language | Albanian |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-030288938 |
oclc_num | 1031052346 |
open_access_boolean | |
owner | DE-12 |
owner_facet | DE-12 |
physical | 223 Seiten Illustrationen, Diagramme 24 cm |
publishDate | 2014 |
publishDateSearch | 2014 |
publishDateSort | 2014 |
publisher | Dita 2000 |
record_format | marc |
spelling | Sufaj, Fehmi Verfasser aut Sistemi i ndëshkimeve në Shqipëri gjatë regjimit komunist (1945-1990) Dr. Femi Sufaj Tiranë Dita 2000 2014 223 Seiten Illustrationen, Diagramme 24 cm txt rdacontent n rdamedia nc rdacarrier Geschichte 1944-1991 gnd rswk-swf Kommunismus (DE-588)4031892-8 gnd rswk-swf Politischer Gefangener (DE-588)4076230-0 gnd rswk-swf Strafrecht (DE-588)4057795-8 gnd rswk-swf Arbeitslager (DE-588)4002716-8 gnd rswk-swf Gefängnis (DE-588)4071628-4 gnd rswk-swf Diktatur (DE-588)4149920-7 gnd rswk-swf Todesstrafe (DE-588)4060306-4 gnd rswk-swf Albanien (DE-588)4001028-4 gnd rswk-swf Albanien (DE-588)4001028-4 g Kommunismus (DE-588)4031892-8 s Diktatur (DE-588)4149920-7 s Strafrecht (DE-588)4057795-8 s Gefängnis (DE-588)4071628-4 s Arbeitslager (DE-588)4002716-8 s Todesstrafe (DE-588)4060306-4 s Politischer Gefangener (DE-588)4076230-0 s Geschichte 1944-1991 z DE-604 Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030288938&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030288938&sequence=000002&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA Abstract Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030288938&sequence=000003&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA Literaturverzeichnis |
spellingShingle | Sufaj, Fehmi Sistemi i ndëshkimeve në Shqipëri gjatë regjimit komunist (1945-1990) Kommunismus (DE-588)4031892-8 gnd Politischer Gefangener (DE-588)4076230-0 gnd Strafrecht (DE-588)4057795-8 gnd Arbeitslager (DE-588)4002716-8 gnd Gefängnis (DE-588)4071628-4 gnd Diktatur (DE-588)4149920-7 gnd Todesstrafe (DE-588)4060306-4 gnd |
subject_GND | (DE-588)4031892-8 (DE-588)4076230-0 (DE-588)4057795-8 (DE-588)4002716-8 (DE-588)4071628-4 (DE-588)4149920-7 (DE-588)4060306-4 (DE-588)4001028-4 |
title | Sistemi i ndëshkimeve në Shqipëri gjatë regjimit komunist (1945-1990) |
title_auth | Sistemi i ndëshkimeve në Shqipëri gjatë regjimit komunist (1945-1990) |
title_exact_search | Sistemi i ndëshkimeve në Shqipëri gjatë regjimit komunist (1945-1990) |
title_full | Sistemi i ndëshkimeve në Shqipëri gjatë regjimit komunist (1945-1990) Dr. Femi Sufaj |
title_fullStr | Sistemi i ndëshkimeve në Shqipëri gjatë regjimit komunist (1945-1990) Dr. Femi Sufaj |
title_full_unstemmed | Sistemi i ndëshkimeve në Shqipëri gjatë regjimit komunist (1945-1990) Dr. Femi Sufaj |
title_short | Sistemi i ndëshkimeve në Shqipëri gjatë regjimit komunist |
title_sort | sistemi i ndeshkimeve ne shqiperi gjate regjimit komunist 1945 1990 |
title_sub | (1945-1990) |
topic | Kommunismus (DE-588)4031892-8 gnd Politischer Gefangener (DE-588)4076230-0 gnd Strafrecht (DE-588)4057795-8 gnd Arbeitslager (DE-588)4002716-8 gnd Gefängnis (DE-588)4071628-4 gnd Diktatur (DE-588)4149920-7 gnd Todesstrafe (DE-588)4060306-4 gnd |
topic_facet | Kommunismus Politischer Gefangener Strafrecht Arbeitslager Gefängnis Diktatur Todesstrafe Albanien |
url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030288938&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030288938&sequence=000002&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030288938&sequence=000003&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA |
work_keys_str_mv | AT sufajfehmi sistemiindeshkimeveneshqiperigjateregjimitkomunist19451990 |