Slovensko, Európa a svet na starých mapách a v grafických vyobrazeniach historických tlačí 15. až 18. storočia z fondov a zbierok Slovenskej národnej knižnice: = Slovakia, Europe and the world on old maps and graphic representations in historical prints made between the 15th and the 18th centuries from the Collections of the Slovak National Library = Slowakei, Europa und die Welt in alten Karten und graphischen Darstellungen der historischen Drucken des 15.-18. Jahrhunderts aus Beständen und Sammlungen der Slowakischen Nationalbibliothek
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | Slovak English German |
| Veröffentlicht: |
Martin
Slovenská národná knižnica
2017
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | Literaturverzeichnis Seite 386-390 |
| Beschreibung: | 390 Seiten Illustrationen, Karten (farbig) |
| ISBN: | 9788081490804 |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV044872515 | ||
| 003 | DE-604 | ||
| 005 | 20190711 | ||
| 007 | t | ||
| 008 | 180319s2017 a||| |||| 00||| slo d | ||
| 020 | |a 9788081490804 |9 978-80-8149-080-4 | ||
| 035 | |a (OCoLC)1061555693 | ||
| 035 | |a (DE-599)BVBBV044872515 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a slo |a eng |a ger | |
| 049 | |a DE-Re13 |a DE-12 | ||
| 084 | |a OST |q DE-12 |2 fid | ||
| 110 | 2 | |a Slovenská Národná Knižnica |0 (DE-588)5016394-2 |4 isb | |
| 245 | 1 | 0 | |a Slovensko, Európa a svet na starých mapách a v grafických vyobrazeniach historických tlačí 15. až 18. storočia z fondov a zbierok Slovenskej národnej knižnice |b = Slovakia, Europe and the world on old maps and graphic representations in historical prints made between the 15th and the 18th centuries from the Collections of the Slovak National Library = Slowakei, Europa und die Welt in alten Karten und graphischen Darstellungen der historischen Drucken des 15.-18. Jahrhunderts aus Beständen und Sammlungen der Slowakischen Nationalbibliothek |c Ľubomír Jankovič ; Slovenská národná knižnica |
| 246 | 1 | 3 | |a Slovensko, Európa a svet |
| 246 | 1 | 1 | |a Slovakia, Europe and the world on old maps and graphic representations in historical prints made between the 15th and the 18th centuries from the Collections of the Slovak National Library |
| 246 | 1 | 1 | |a Slowakei, Europa und die Welt in alten Karten und graphischen Darstellungen der historischen Drucken des 15.-18. Jahrhunderts aus Beständen und Sammlungen der Slowakischen Nationalbibliothek |
| 264 | 1 | |a Martin |b Slovenská národná knižnica |c 2017 | |
| 300 | |a 390 Seiten |b Illustrationen, Karten (farbig) | ||
| 336 | |b txt |2 rdacontent | ||
| 336 | |b sti |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 500 | |a Literaturverzeichnis Seite 386-390 | ||
| 546 | |a Text slowakisch, Zusammenfassung in englischer und deutscher Sprache | ||
| 610 | 2 | 7 | |a Slovenská Národná Knižnica |0 (DE-588)5016394-2 |2 gnd |9 rswk-swf |
| 648 | 7 | |a Geschichte 1483-1800 |2 gnd |9 rswk-swf | |
| 650 | 0 | 7 | |a Vedute |0 (DE-588)4001393-5 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Altkarte |0 (DE-588)4611904-8 |2 gnd |9 rswk-swf |
| 655 | 7 | |0 (DE-588)4145395-5 |a Bildband |2 gnd-content | |
| 689 | 0 | 0 | |a Slovenská Národná Knižnica |0 (DE-588)5016394-2 |D b |
| 689 | 0 | 1 | |a Altkarte |0 (DE-588)4611904-8 |D s |
| 689 | 0 | 2 | |a Vedute |0 (DE-588)4001393-5 |D s |
| 689 | 0 | 3 | |a Geschichte 1483-1800 |A z |
| 689 | 0 | |5 DE-604 | |
| 700 | 1 | |a Jankovič, Ľubomír |d 1960- |0 (DE-588)136563589 |4 aut |4 com | |
| 775 | 0 | 8 | |i Übersetzt als |t Slovakia, Europe and the world on old maps and graphic representations in historical works from the fifteenth to the eighteenth century in the collection of the Slovak National Library |d Martin : Slovak National Library, 2018 |w (DE-604)BV045903046 |
| 787 | 0 | 8 | |i In Beziehung stehendes Werk |a Jankovič, Ľubomír |t Inkunábuly : umenie európskych knižných tvorcov 15. storočia v zbierke Slovenskej národnej knižnice |d Martin : Slovenská národná knižnica, 2014 |w (DE-604)BV045380055 |
| 787 | 0 | 8 | |i In Beziehung stehendes Werk |a Jankovič, Ľubomír |t Klenoty knižnej kultúry a archívneho dokumentárneho dedičstva v zbierkach Slovenskej národnej knižnice v Martine |d Martin : Kozák Press, 2010 |w (DE-604)BV037193509 |
| 856 | 4 | 2 | |m Digitalisierung BSB München 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030266916&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 940 | 1 | |n oe | |
| 940 | 1 | |q BSB_NED_20190613 | |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-030266916 | ||
| 942 | 1 | 1 | |c 911 |e 22/bsb |f 09024 |g 4373 |
| 942 | 1 | 1 | |c 911 |e 22/bsb |f 0903 |g 4373 |
| 942 | 1 | 1 | |c 020 |e 22/bsb |g 4373 |
Datensatz im Suchindex
| _version_ | 1804178404540416000 |
|---|---|
| adam_text | Obsah
Uvodom 5
Metodicke a bibliograficke poznämky 14
Pouzite skratky 15
Stare mapy, atlasy, veduty a mestske pläny
v kontextoch dejin euröpskej kartografie,
grafickej ilusträcie a kniznej kultüry 17
Mapy, veduty a mestske pläny
prvych tlacenych vydani kronik a cestopisov 15. storocia 19
Mapy, veduty a mestske pläny
v atlasoch a historicko-geografickej spisbe 16. storocia 55
Mapy, veduty a mestske pläny
v atlasoch a historicko-geografickej spisbe 17. storocia 123
Mapy, veduty a mestske pläny
v atlasoch a historicko-geografickej spisbe 18. storocia 289
Bibliograficky katalög kniznych diel, atlasov, mäp, vedüt
a grafickych vyobrazeni 341
Autori geografickych diel a cestopisov, tvorcovia mäp
a atlasov, vedüt a mestskych plänov, tlaciari,
nakladatelia a vydavatelia 349
Summary 375
Zusammenfassung 380
Literatüra 386
|
| any_adam_object | 1 |
| author | Jankovič, Ľubomír 1960- |
| author2 | Jankovič, Ľubomír 1960- |
| author2_role | com |
| author2_variant | ľ j ľj |
| author_GND | (DE-588)136563589 |
| author_facet | Jankovič, Ľubomír 1960- Jankovič, Ľubomír 1960- |
| author_role | aut |
| author_sort | Jankovič, Ľubomír 1960- |
| author_variant | ľ j ľj |
| building | Verbundindex |
| bvnumber | BV044872515 |
| ctrlnum | (OCoLC)1061555693 (DE-599)BVBBV044872515 |
| era | Geschichte 1483-1800 gnd |
| era_facet | Geschichte 1483-1800 |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>03811nam a2200577 c 4500</leader><controlfield tag="001">BV044872515</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20190711 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">180319s2017 a||| |||| 00||| slo d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9788081490804</subfield><subfield code="9">978-80-8149-080-4</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1061555693</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV044872515</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">slo</subfield><subfield code="a">eng</subfield><subfield code="a">ger</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-Re13</subfield><subfield code="a">DE-12</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">OST</subfield><subfield code="q">DE-12</subfield><subfield code="2">fid</subfield></datafield><datafield tag="110" ind1="2" ind2=" "><subfield code="a">Slovenská Národná Knižnica</subfield><subfield code="0">(DE-588)5016394-2</subfield><subfield code="4">isb</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Slovensko, Európa a svet na starých mapách a v grafických vyobrazeniach historických tlačí 15. až 18. storočia z fondov a zbierok Slovenskej národnej knižnice</subfield><subfield code="b">= Slovakia, Europe and the world on old maps and graphic representations in historical prints made between the 15th and the 18th centuries from the Collections of the Slovak National Library = Slowakei, Europa und die Welt in alten Karten und graphischen Darstellungen der historischen Drucken des 15.-18. Jahrhunderts aus Beständen und Sammlungen der Slowakischen Nationalbibliothek</subfield><subfield code="c">Ľubomír Jankovič ; Slovenská národná knižnica</subfield></datafield><datafield tag="246" ind1="1" ind2="3"><subfield code="a">Slovensko, Európa a svet</subfield></datafield><datafield tag="246" ind1="1" ind2="1"><subfield code="a">Slovakia, Europe and the world on old maps and graphic representations in historical prints made between the 15th and the 18th centuries from the Collections of the Slovak National Library</subfield></datafield><datafield tag="246" ind1="1" ind2="1"><subfield code="a">Slowakei, Europa und die Welt in alten Karten und graphischen Darstellungen der historischen Drucken des 15.-18. Jahrhunderts aus Beständen und Sammlungen der Slowakischen Nationalbibliothek</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Martin</subfield><subfield code="b">Slovenská národná knižnica</subfield><subfield code="c">2017</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">390 Seiten</subfield><subfield code="b">Illustrationen, Karten (farbig)</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">sti</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Literaturverzeichnis Seite 386-390</subfield></datafield><datafield tag="546" ind1=" " ind2=" "><subfield code="a">Text slowakisch, Zusammenfassung in englischer und deutscher Sprache</subfield></datafield><datafield tag="610" ind1="2" ind2="7"><subfield code="a">Slovenská Národná Knižnica</subfield><subfield code="0">(DE-588)5016394-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte 1483-1800</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Vedute</subfield><subfield code="0">(DE-588)4001393-5</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Altkarte</subfield><subfield code="0">(DE-588)4611904-8</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)4145395-5</subfield><subfield code="a">Bildband</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Slovenská Národná Knižnica</subfield><subfield code="0">(DE-588)5016394-2</subfield><subfield code="D">b</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Altkarte</subfield><subfield code="0">(DE-588)4611904-8</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Vedute</subfield><subfield code="0">(DE-588)4001393-5</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Geschichte 1483-1800</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Jankovič, Ľubomír</subfield><subfield code="d">1960-</subfield><subfield code="0">(DE-588)136563589</subfield><subfield code="4">aut</subfield><subfield code="4">com</subfield></datafield><datafield tag="775" ind1="0" ind2="8"><subfield code="i">Übersetzt als</subfield><subfield code="t">Slovakia, Europe and the world on old maps and graphic representations in historical works from the fifteenth to the eighteenth century in the collection of the Slovak National Library</subfield><subfield code="d">Martin : Slovak National Library, 2018</subfield><subfield code="w">(DE-604)BV045903046</subfield></datafield><datafield tag="787" ind1="0" ind2="8"><subfield code="i">In Beziehung stehendes Werk</subfield><subfield code="a">Jankovič, Ľubomír</subfield><subfield code="t">Inkunábuly : umenie európskych knižných tvorcov 15. storočia v zbierke Slovenskej národnej knižnice</subfield><subfield code="d">Martin : Slovenská národná knižnica, 2014</subfield><subfield code="w">(DE-604)BV045380055</subfield></datafield><datafield tag="787" ind1="0" ind2="8"><subfield code="i">In Beziehung stehendes Werk</subfield><subfield code="a">Jankovič, Ľubomír</subfield><subfield code="t">Klenoty knižnej kultúry a archívneho dokumentárneho dedičstva v zbierkach Slovenskej národnej knižnice v Martine</subfield><subfield code="d">Martin : Kozák Press, 2010</subfield><subfield code="w">(DE-604)BV037193509</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030266916&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">oe</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">BSB_NED_20190613</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-030266916</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">911</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09024</subfield><subfield code="g">4373</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">911</subfield><subfield code="e">22/bsb</subfield><subfield code="f">0903</subfield><subfield code="g">4373</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">020</subfield><subfield code="e">22/bsb</subfield><subfield code="g">4373</subfield></datafield></record></collection> |
| genre | (DE-588)4145395-5 Bildband gnd-content |
| genre_facet | Bildband |
| id | DE-604.BV044872515 |
| illustrated | Illustrated |
| indexdate | 2024-07-10T08:03:26Z |
| institution | BVB |
| institution_GND | (DE-588)5016394-2 |
| isbn | 9788081490804 |
| language | Slovak English German |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-030266916 |
| oclc_num | 1061555693 |
| open_access_boolean | |
| owner | DE-Re13 DE-BY-UBR DE-12 |
| owner_facet | DE-Re13 DE-BY-UBR DE-12 |
| physical | 390 Seiten Illustrationen, Karten (farbig) |
| psigel | BSB_NED_20190613 |
| publishDate | 2017 |
| publishDateSearch | 2017 |
| publishDateSort | 2017 |
| publisher | Slovenská národná knižnica |
| record_format | marc |
| spelling | Slovenská Národná Knižnica (DE-588)5016394-2 isb Slovensko, Európa a svet na starých mapách a v grafických vyobrazeniach historických tlačí 15. až 18. storočia z fondov a zbierok Slovenskej národnej knižnice = Slovakia, Europe and the world on old maps and graphic representations in historical prints made between the 15th and the 18th centuries from the Collections of the Slovak National Library = Slowakei, Europa und die Welt in alten Karten und graphischen Darstellungen der historischen Drucken des 15.-18. Jahrhunderts aus Beständen und Sammlungen der Slowakischen Nationalbibliothek Ľubomír Jankovič ; Slovenská národná knižnica Slovensko, Európa a svet Slovakia, Europe and the world on old maps and graphic representations in historical prints made between the 15th and the 18th centuries from the Collections of the Slovak National Library Slowakei, Europa und die Welt in alten Karten und graphischen Darstellungen der historischen Drucken des 15.-18. Jahrhunderts aus Beständen und Sammlungen der Slowakischen Nationalbibliothek Martin Slovenská národná knižnica 2017 390 Seiten Illustrationen, Karten (farbig) txt rdacontent sti rdacontent n rdamedia nc rdacarrier Literaturverzeichnis Seite 386-390 Text slowakisch, Zusammenfassung in englischer und deutscher Sprache Slovenská Národná Knižnica (DE-588)5016394-2 gnd rswk-swf Geschichte 1483-1800 gnd rswk-swf Vedute (DE-588)4001393-5 gnd rswk-swf Altkarte (DE-588)4611904-8 gnd rswk-swf (DE-588)4145395-5 Bildband gnd-content Slovenská Národná Knižnica (DE-588)5016394-2 b Altkarte (DE-588)4611904-8 s Vedute (DE-588)4001393-5 s Geschichte 1483-1800 z DE-604 Jankovič, Ľubomír 1960- (DE-588)136563589 aut com Übersetzt als Slovakia, Europe and the world on old maps and graphic representations in historical works from the fifteenth to the eighteenth century in the collection of the Slovak National Library Martin : Slovak National Library, 2018 (DE-604)BV045903046 In Beziehung stehendes Werk Jankovič, Ľubomír Inkunábuly : umenie európskych knižných tvorcov 15. storočia v zbierke Slovenskej národnej knižnice Martin : Slovenská národná knižnica, 2014 (DE-604)BV045380055 In Beziehung stehendes Werk Jankovič, Ľubomír Klenoty knižnej kultúry a archívneho dokumentárneho dedičstva v zbierkach Slovenskej národnej knižnice v Martine Martin : Kozák Press, 2010 (DE-604)BV037193509 Digitalisierung BSB München 19 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030266916&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Jankovič, Ľubomír 1960- Slovensko, Európa a svet na starých mapách a v grafických vyobrazeniach historických tlačí 15. až 18. storočia z fondov a zbierok Slovenskej národnej knižnice = Slovakia, Europe and the world on old maps and graphic representations in historical prints made between the 15th and the 18th centuries from the Collections of the Slovak National Library = Slowakei, Europa und die Welt in alten Karten und graphischen Darstellungen der historischen Drucken des 15.-18. Jahrhunderts aus Beständen und Sammlungen der Slowakischen Nationalbibliothek Slovenská Národná Knižnica (DE-588)5016394-2 gnd Vedute (DE-588)4001393-5 gnd Altkarte (DE-588)4611904-8 gnd |
| subject_GND | (DE-588)5016394-2 (DE-588)4001393-5 (DE-588)4611904-8 (DE-588)4145395-5 |
| title | Slovensko, Európa a svet na starých mapách a v grafických vyobrazeniach historických tlačí 15. až 18. storočia z fondov a zbierok Slovenskej národnej knižnice = Slovakia, Europe and the world on old maps and graphic representations in historical prints made between the 15th and the 18th centuries from the Collections of the Slovak National Library = Slowakei, Europa und die Welt in alten Karten und graphischen Darstellungen der historischen Drucken des 15.-18. Jahrhunderts aus Beständen und Sammlungen der Slowakischen Nationalbibliothek |
| title_alt | Slovensko, Európa a svet Slovakia, Europe and the world on old maps and graphic representations in historical prints made between the 15th and the 18th centuries from the Collections of the Slovak National Library Slowakei, Europa und die Welt in alten Karten und graphischen Darstellungen der historischen Drucken des 15.-18. Jahrhunderts aus Beständen und Sammlungen der Slowakischen Nationalbibliothek |
| title_auth | Slovensko, Európa a svet na starých mapách a v grafických vyobrazeniach historických tlačí 15. až 18. storočia z fondov a zbierok Slovenskej národnej knižnice = Slovakia, Europe and the world on old maps and graphic representations in historical prints made between the 15th and the 18th centuries from the Collections of the Slovak National Library = Slowakei, Europa und die Welt in alten Karten und graphischen Darstellungen der historischen Drucken des 15.-18. Jahrhunderts aus Beständen und Sammlungen der Slowakischen Nationalbibliothek |
| title_exact_search | Slovensko, Európa a svet na starých mapách a v grafických vyobrazeniach historických tlačí 15. až 18. storočia z fondov a zbierok Slovenskej národnej knižnice = Slovakia, Europe and the world on old maps and graphic representations in historical prints made between the 15th and the 18th centuries from the Collections of the Slovak National Library = Slowakei, Europa und die Welt in alten Karten und graphischen Darstellungen der historischen Drucken des 15.-18. Jahrhunderts aus Beständen und Sammlungen der Slowakischen Nationalbibliothek |
| title_full | Slovensko, Európa a svet na starých mapách a v grafických vyobrazeniach historických tlačí 15. až 18. storočia z fondov a zbierok Slovenskej národnej knižnice = Slovakia, Europe and the world on old maps and graphic representations in historical prints made between the 15th and the 18th centuries from the Collections of the Slovak National Library = Slowakei, Europa und die Welt in alten Karten und graphischen Darstellungen der historischen Drucken des 15.-18. Jahrhunderts aus Beständen und Sammlungen der Slowakischen Nationalbibliothek Ľubomír Jankovič ; Slovenská národná knižnica |
| title_fullStr | Slovensko, Európa a svet na starých mapách a v grafických vyobrazeniach historických tlačí 15. až 18. storočia z fondov a zbierok Slovenskej národnej knižnice = Slovakia, Europe and the world on old maps and graphic representations in historical prints made between the 15th and the 18th centuries from the Collections of the Slovak National Library = Slowakei, Europa und die Welt in alten Karten und graphischen Darstellungen der historischen Drucken des 15.-18. Jahrhunderts aus Beständen und Sammlungen der Slowakischen Nationalbibliothek Ľubomír Jankovič ; Slovenská národná knižnica |
| title_full_unstemmed | Slovensko, Európa a svet na starých mapách a v grafických vyobrazeniach historických tlačí 15. až 18. storočia z fondov a zbierok Slovenskej národnej knižnice = Slovakia, Europe and the world on old maps and graphic representations in historical prints made between the 15th and the 18th centuries from the Collections of the Slovak National Library = Slowakei, Europa und die Welt in alten Karten und graphischen Darstellungen der historischen Drucken des 15.-18. Jahrhunderts aus Beständen und Sammlungen der Slowakischen Nationalbibliothek Ľubomír Jankovič ; Slovenská národná knižnica |
| title_short | Slovensko, Európa a svet na starých mapách a v grafických vyobrazeniach historických tlačí 15. až 18. storočia z fondov a zbierok Slovenskej národnej knižnice |
| title_sort | slovensko europa a svet na starych mapach a v grafickych vyobrazeniach historickych tlaci 15 az 18 storocia z fondov a zbierok slovenskej narodnej kniznice slovakia europe and the world on old maps and graphic representations in historical prints made between the 15th and the 18th centuries from the collections of the slovak national library slowakei europa und die welt in alten karten und graphischen darstellungen der historischen drucken des 15 18 jahrhunderts aus bestanden und sammlungen der slowakischen nationalbibliothek |
| title_sub | = Slovakia, Europe and the world on old maps and graphic representations in historical prints made between the 15th and the 18th centuries from the Collections of the Slovak National Library = Slowakei, Europa und die Welt in alten Karten und graphischen Darstellungen der historischen Drucken des 15.-18. Jahrhunderts aus Beständen und Sammlungen der Slowakischen Nationalbibliothek |
| topic | Slovenská Národná Knižnica (DE-588)5016394-2 gnd Vedute (DE-588)4001393-5 gnd Altkarte (DE-588)4611904-8 gnd |
| topic_facet | Slovenská Národná Knižnica Vedute Altkarte Bildband |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030266916&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT slovenskanarodnakniznica slovenskoeuropaasvetnastarychmapachavgrafickychvyobrazeniachhistorickychtlaci15az18storociazfondovazbierokslovenskejnarodnejknizniceslovakiaeuropeandtheworldonoldmapsandgraphicrepresentationsinhistoricalprintsmadebetweenthe15thandthe18thcenturiesfromtheco AT jankoviclubomir slovenskoeuropaasvetnastarychmapachavgrafickychvyobrazeniachhistorickychtlaci15az18storociazfondovazbierokslovenskejnarodnejknizniceslovakiaeuropeandtheworldonoldmapsandgraphicrepresentationsinhistoricalprintsmadebetweenthe15thandthe18thcenturiesfromtheco AT slovenskanarodnakniznica slovenskoeuropaasvet AT jankoviclubomir slovenskoeuropaasvet AT slovenskanarodnakniznica slovakiaeuropeandtheworldonoldmapsandgraphicrepresentationsinhistoricalprintsmadebetweenthe15thandthe18thcenturiesfromthecollectionsoftheslovaknationallibrary AT jankoviclubomir slovakiaeuropeandtheworldonoldmapsandgraphicrepresentationsinhistoricalprintsmadebetweenthe15thandthe18thcenturiesfromthecollectionsoftheslovaknationallibrary AT slovenskanarodnakniznica slowakeieuropaunddieweltinaltenkartenundgraphischendarstellungenderhistorischendruckendes1518jahrhundertsausbestandenundsammlungenderslowakischennationalbibliothek AT jankoviclubomir slowakeieuropaunddieweltinaltenkartenundgraphischendarstellungenderhistorischendruckendes1518jahrhundertsausbestandenundsammlungenderslowakischennationalbibliothek |