"O nový československý model socialismu": edice dokumentů ke čtyřem interdisciplinárním vědeckým týmům při ČSAV a UK v 60. letech = "Striving for a new Czechoslovak model of socialism" : edition of documents on four interdisciplinary scientific teams of the Czechoslovak Academy of Sciences and the Charles University in the 1960s
Gespeichert in:
| Hauptverfasser: | , , , |
|---|---|
| Format: | Buch |
| Sprache: | Czech |
| Veröffentlicht: |
Praha
Ústav pro soudobé dějiny AV ČR, v.v.i.
2016
|
| Schriftenreihe: | Sešity Ústavu pro soudobé dějiny
sv. 50 |
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis Abstract Literaturverzeichnis Register // Personenregister |
| Beschreibung: | 236 Seiten |
| ISBN: | 9788072852017 |
Internformat
MARC
| LEADER | 00000nam a2200000 cb4500 | ||
|---|---|---|---|
| 001 | BV044617778 | ||
| 003 | DE-604 | ||
| 005 | 20211124 | ||
| 007 | t | ||
| 008 | 171108s2016 m||| 00||| cze d | ||
| 020 | |a 9788072852017 |9 978-80-7285-201-7 | ||
| 035 | |a (OCoLC)1015871262 | ||
| 035 | |a (DE-599)BSZ493542981 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a cze | |
| 049 | |a DE-739 |a DE-12 | ||
| 084 | |a OST |q DE-12 |2 fid | ||
| 084 | |a NK 2470 |0 (DE-625)125896: |2 rvk | ||
| 084 | |a NQ 8273 |0 (DE-625)128968: |2 rvk | ||
| 100 | 1 | |a Hoppe, Jiří |d 1968- |e Verfasser |0 (DE-588)139866086 |4 aut | |
| 245 | 1 | 0 | |a "O nový československý model socialismu" |b edice dokumentů ke čtyřem interdisciplinárním vědeckým týmům při ČSAV a UK v 60. letech = "Striving for a new Czechoslovak model of socialism" : edition of documents on four interdisciplinary scientific teams of the Czechoslovak Academy of Sciences and the Charles University in the 1960s |c Jiří Hoppe, Markéta Škodová, Jiří Suk, Francesco Caccamo |
| 246 | 1 | 1 | |a "Striving for a new Czechoslovak model of socialism" |
| 264 | 1 | |a Praha |b Ústav pro soudobé dějiny AV ČR, v.v.i. |c 2016 | |
| 300 | |a 236 Seiten | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 1 | |a Sešity Ústavu pro soudobé dějiny |v sv. 50 | |
| 546 | |a Zusammenfassung auf Englisch | ||
| 648 | 7 | |a Geschichte 1960-1970 |2 gnd |9 rswk-swf | |
| 650 | 0 | 7 | |a Politische Wissenschaft |0 (DE-588)4076229-4 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Sozialismus |0 (DE-588)4055785-6 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Sozialwissenschaften |0 (DE-588)4055916-6 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Wirtschaftswissenschaften |0 (DE-588)4066528-8 |2 gnd |9 rswk-swf |
| 651 | 7 | |a Tschechoslowakei |0 (DE-588)4078435-6 |2 gnd |9 rswk-swf | |
| 655 | 7 | |0 (DE-588)4135952-5 |a Quelle |2 gnd-content | |
| 689 | 0 | 0 | |a Tschechoslowakei |0 (DE-588)4078435-6 |D g |
| 689 | 0 | 1 | |a Sozialismus |0 (DE-588)4055785-6 |D s |
| 689 | 0 | 2 | |a Wirtschaftswissenschaften |0 (DE-588)4066528-8 |D s |
| 689 | 0 | 3 | |a Sozialwissenschaften |0 (DE-588)4055916-6 |D s |
| 689 | 0 | 4 | |a Politische Wissenschaft |0 (DE-588)4076229-4 |D s |
| 689 | 0 | 5 | |a Geschichte 1960-1970 |A z |
| 689 | 0 | |5 DE-604 | |
| 700 | 1 | |a Škodová, Markéta |e Verfasser |4 aut | |
| 700 | 1 | |a Suk, Jiří |d 1966- |e Verfasser |0 (DE-588)137899343 |4 aut | |
| 700 | 1 | |a Caccamo, Francesco |d ca. 20./21. Jh. |e Verfasser |0 (DE-588)1246388197 |4 aut | |
| 830 | 0 | |a Sešity Ústavu pro soudobé dějiny |v sv. 50 |w (DE-604)BV010182532 |9 50 | |
| 856 | 4 | 2 | |m HEBIS Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030016111&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 856 | 4 | 2 | |m Digitalisierung BSB München 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030016111&sequence=000006&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |3 Abstract |
| 856 | 4 | 2 | |m Digitalisierung BSB München 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030016111&sequence=000007&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA |3 Literaturverzeichnis |
| 856 | 4 | 2 | |m Digitalisierung BSB München 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030016111&sequence=000008&line_number=0004&func_code=DB_RECORDS&service_type=MEDIA |3 Register // Personenregister |
| 940 | 1 | |n oe | |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-030016111 | ||
| 942 | 1 | 1 | |c 909 |e 22/bsb |f 0904 |g 437 |
| 942 | 1 | 1 | |c 330.09 |e 22/bsb |f 0904 |g 437 |
| 942 | 1 | 1 | |c 306.09 |e 22/bsb |f 0904 |g 437 |
Datensatz im Suchindex
| _version_ | 1804178016533741568 |
|---|---|
| adam_text | (0 rows affected)
SUMMARY
The present edition of documents is one of the deliverables of the
project named “Striving for a New Czechoslovak Model of Socialism. ” Four
Interdisciplinary Scientific Teams of the Czechoslovak Academy of Sciences
and the Charles University in the 1960s, funded by the Grant Agency of the
Czech Republic. The book is a follow-up to and complements a collective
monograph published under the same programme a year ago.1
The edition contains altogether 34 documents selected by the authors
of each of the chapters of the collective monograph: Jifi Suk on Sik’s team
(Documents No. 1 to No. 9), Jifi Hoppe on Richta’s team (Documents
No. 10 to No. 17), Markets Skodova on Machonin s team (Documents
No. 18 to No. 26), and Francesco Caccamo on Mlynafs team (Documents
No. 27 to No. 34), The selection criteria were rather loose. Members of
the project team agreed that the publication should be as brief as possible,
and their opinion is reflected in a relatively low number of documents
comprising the edition; as a matter of fact, reprinting longer and (viewed
from the perspective of the project as a whole) partial documents would
have made the edition too extensive and less easy to find one s way in. By
his or her personally selected anthology, each of the authors answered
a question which documents had helped him or her understand the
topic (team) best, and which could thus be regarded as essential. In
fact, the edition lets the historical characters themselves (team leaders,
collaborators, commentators, or opponents) speak about relevant issues,
who are thus given an opportunity to present their original plans, methods
or approaches to tasks, as well as the results they achieved, themselves.
On the other hand, the reader can make, thanks to period documents
and texts, a more accurate and colourful picture of the overall socio-
political context of those times, reasons why the teams were established,
circumstances accompanying their formation and fleshing out, their
1 HOPPE, Jifi - SKODOVÄ, Marketa - SUK, Jifi - CACCAMO, Francesco: „O novy
ceskoslovensky model socialisms“ Ctyfi interdisciplinarni vedecke tymy pfi CSAV a UK
v 60. letech (,,Striving for a New Czechoslovak Model of Socialism. ’’Four Interdisciplinary
Scientific Teams of the Czechoslovak Academy of Sciences and the Charles University in
the 1960sy ÜSD AV CR (Institute for Contemporary History), Praha (Prague) 2015.
233
everyday activities, specific outputs, or of impacts of their teamwork on
scientific activities or certain segments of the society.
Jiri Suk s selection focuses on analytic texts revealing the substance,
depth, and consequences of the difficulties which the Czechoslovak
economy was struggling with at that that time. In a more or less explicit
manner, they point at systemic deficiencies, half-baked ideas, illogical
concepts, or plain sloppiness which, at the end of the day, caused
a situation in which the economy basically was not performing its natural
role, i.e. meeting needs of people. In the 1960s, the situation resulted in
a necessity to reform the economy, but the reform inevitably had to have,
and indeed did have, impacts on the political sphere.
Jiri Hoppe built his selection around the person of Radovana Richta,
who had managed to convert and elaborate the earliest and very brief
theses on the forthcoming scientific and technical revolution into
a comprehensive, original, and purely Czechoslovak concept. The
attention is focused on the formulation of the idea, progress of work,
building of the team, and ultimately also the publication of the then
world-renowned book “Civilization at the Crossroads”. The documents,
one of the authors of which is, among others, Richta himself, contain, for
example, a list of partial results of the team, their reflection in the society
or at party meetings, or reactions to translations of the book to various
foreign languages. Final documents show how some members of the team
adapted themselves to the new conditions prevailing since August 1968,
or rather since September 1969, when the invasion of Czechoslovakia by
armies of the Warsaw was renamed “internationalist help”.
The texts selected by Markéta Skodovâ present (often bywords of Pavel
Machonin himself) both sociological research topics and projects of the
period and the team s key task, namely a sociologico-statistical survey
of the vertical social stratification and mobility of Czechoslovakia’s
population. The selected documents prove that the survey was indeed
extremely extensive, and no project of a similar size was ever undertaken
before or after it. They also clearly show the significance assigned to the
survey by the community of researchers as well as by state and party
institutions and organs. Although the most important results of several
years of work were published in the “Czechoslovak Society” monograph,
the last document shows that intensive work on other output was also
going on, but these remained in a fragmentary state because of political
events.
234
The team responsible for the development of democracy and the
political system of our society had been moving in the closely guarded
fiefdom of the Communist Party, namely in the field of studies of methods
of exercising power and their potential transformations, and this was the
reason why Francesco Caccamo could rely mainly on contents of archival
depots. He published Zdenek Mlynar’s initial considerations concerning
the project’s orientation, structure, tasks, and missions from the very rich
personal archive of Mlynar. The next part of his selection shows ways and
methods that helped refine opinions or give birth to some complementary
studies. Although efforts of Mlynar’s team did not produce any tangible
results, the documents presented in Caccamo’s part of the edition
indicate an endeavour for relatively substantial changes, including those
of principles concerning the application of the so-called leading role of
the Communist Party of Czechoslovakia in the state and society.
The authors decided not to include the Action Programme of the
Communist Party of Czechoslovakia of 5 April 1968 in the edition.
Although a very important collective output of all the teams, it has been
published on countless occasions in various scientific monographs,
selections, or critical editions, and can thus be easily found in any
library or on the Internet. On the other hand, the edition contains
a keynote article of Richta’s team, “Before the decision: Striving for a new
Czechoslovak model of socialism”, (see Document No. 14 - the article was
the inspiration for the project’s), which now seems to escape attention,
but used to be compared with a much more famous manifesto, “The Two
Thousand Words”, in July 1968.
The book contains documents from five archives. The most frequently
represented institution are the National Archives of the Czech Republic
with eight documents, followed by the Archive of the Charles University
and the Archives of the Czech Academy of Sciences with five documents
each; the editors selected one document from the Security Services
Archive and the Archive of the Institute for Contemporary History of the
Czech Academy of Sciences. As to printed media, the edition makes use of
altogether thirteen articles, most of them taken over from the Communist
Party’s daily “Rude pravo” and theoretical and political journal “Nova
mysl” (three each). The “Kulturni tvorba” and “Ekonomicka revue”
journals provided two articles each; and the “Prace” daily and the “Svet
v obrazech” and “Tvorba” magazines provided one article each. One
article was reprinted from a period edition.
235
The oldest document in the edition dates back to August 1961, the most
recent one to March 1970; the edition thus covers the entire period of
the 1960s. The most common type of documents are annual reports,
which suit the requirements best. Of course, specific tasks of each of
the teams was a limiting factor, as was a fragmentary nature of some
archival funds. The most frequent authors of the documents are project
team leaders, the most frequent recipients are superior institutions. The
published documents originated mainly in the territory of Prague and
pertain solely to what is now the territory of the Czech Republic.
The edition is divided into four segments based on the four teams
and arranged chronologically within each group. The documents are
numbered in an ascending order and are provided with short heading
summaries (regesta), with a reference to the archival institution they come
from, an archival signature, and material (numerical) notes explaining
the context and present quotations from the press or other sources. The
authors did not make use of text (alphabetic) notes; however, they have
retained, wherever possible, the original graphic design of the texts.
Transcription of the selected documents concerns mainly prefixes/
prepositions “s” and “z” and the names of institutions, organizations and
ministries according to the latest standards. Square brackets were used to
denote very exceptional interventions into the text.
236
SEZNAM PUBLIKOVANYCH DOKUMENTÚ
Siküv tym
(tym pro teoretické problémy plánovitého f ízení národního
hospodáíství)
1. 1961, 30. srpen, Praha. - Kriticky pohled ekonomické kontrarozvéd-
ky na zpüsob fízení národního hospodárství v souvislosti s krachem
3. pétiletky. (s. 10)
2. 1963, 28. bfezen, Praha. - Clánek cieña Sikova tymu Bohumila Ko-
mendy „Co se mérením produktivity práce nedá vyfesit“, uverejnény
v deníku Rudé právo. První kriticky text o plánování národního hos-
podáíství, ktery vyvolal diskuzi o reformé ceskoslovenské ekonomiky.
(s. 17)
3. 1965,27. kvéten, Praha. - Dopis pr edsedy ekonomické komise ÚV KSC
Drahomíra Koldera prvnímu tajemníkovi ÚV KSC Antonínu Novotné-
mu, obsahující kriticky pojatou charakteristiku prací na ekonomické
reformé. (s. 23)
4. 1967, 21. bfezen, Praha. - Polemika Sikovych „revizionistü“ Cestmíra
Kozusníka a Zdenka Kodeta ,,Co je a co není nové pojetí plánu a trhu“
s clánkem „dogmatika“ Jaroslava Vejvody „O plánu, trhu, monopolu
a konkurenci“, uverejnéná v casopisu Nová mysl. (s. 28)
5. 1967,31. brezen -1. duben, Praha. - Projev Jaroslava Fornüska na val-
ném shromázdéní Ceskoslovenské spolecnosti ekonomické. (s. 34)
6. 1967, zárí, Praha. - Clánek predního ekonomického reformisty Jin-
dricha Janise „Kritika kapitalismu: smysl a predpoklady“, uverejnény
v mésícníku Ekonomické revue, v némz píse o nutnosti nepredpojaté
kritiky soudobého kapitalismu. (s. 39)
7. 1967, ríjen, Praha. - Clánek Otakara Turka „O plánu, trhu a hospodár-
ské politice“, uverejnény v mésícníku Ekonomické revue, ve kterém
autor shrnuje obsah vlastní stejnojmenné knihy. (s. 45)
8. 1968, 15. kvéten, Praha. - Clánek Cestmíra Kozusníka „Rozhodující
krok dalsího rozvoje ekonomické reformy“, uverejnény v casopisu
Nová mysl, v némz autor z radikálních pozic kritizuje dosavadní re-
formní úsilí v ceskoslovenské ekonomice. (s. 54)
9. 1968, 15. ríjen, Praha. - Clánek Oty Sika „Konstanty socialismu“,
napsany v cervenci 1968, uverejnény v casopisu Nová mysl, v némz
obhajuje reformní proces, ktery podle néj nenarusí mocenskou domi-
nanci KSC a neohrozí principy socialismu. (s. 63)
229
Richtüv tÿm
(tym pro spolecenské alidské souvislosti vëdeckotechnické revoluce)
10. 1967, 25. kvëten, Praha. - Rozhovor redaktora Vâclava Kotka
s vedoucim tymu Radovanem Richtou, uverejnënÿ v tydeniku
Kulturni tvorba pod näzvem „Logika zmën nasi dobya. (s. 72)
11. 1967, 14. cerven, Praha. - Zpräva vedouciho tymu Radovana Richty
vëdeckému kolegiu fïlozofie a sociologie CSAV, v niz hodnoti vysledky
präce v souvislosti s pripravou XIII. sjezdu KSC. (s. 80)
12. 1968, 31. leden, Tupadly. - Vyrocni zpräva o cinnosti tymu
za rok 1967. (s. 84)
13. 1968, 25. duben, Praha. - Zpräva zästupce vedouciho tymu Oty
Kleina pro vëdecké kolegium fïlozofie a sociologie CSAVo vysledcich
konference Clovëk a spolecnost ve vëdeckotechnické revoluci.
(s. 94)
14. 1968, 10.-12. cervenec, Praha. - Clânek clenû a spolupracovnikû
mezioborového tymu pro vyzkum spolecenskych a lidskych souvislosti
vëdeckotechnické revoluce, nazvanÿ „Pred rozhodnutim (O novy
ceskoslovensky model socialismu)u, uverejnënÿ v deniku Rudé prâvo.
(s. 103)
15. 1968, 17. prosinec, Praha. - Vyrocni zpräva o cinnosti tymu
za rok 1968. (s. 116)
16. 1969, 26. listopad, Praha. - Rozhovor redaktorky Mileny Veselé
s Radovanem Richtou a Jindfichem Filipcem, uverejnënÿ v tydeniku
Tvorba pod näzvem „Svoboda, rizeni a efektivnost vëdy“. (s. 129)
17. 1970, 24. brezen, Praha. - Cast zâpisu ze zasedâni vëdeckého kolegia
fïlozofie a sociologie CSAV s informaci o ükolech souvisejicich
s vÿzkumem vëdeckotechnické revoluce. (s. 139)
Machoninuv tym
(tym pro vÿzkum vertikälni sociâlni diferenciace ceskoslovenské
spolecnosti)
18. 1966, 10. ünor, Praha. - Clânek vedouciho tymu Pavla Machonina
„Novë o sociâlni skutecnosti“, uverejnënÿ v deniku Prace. (s. 144)
19. 1966, konecroku, Praha. - Vÿrocni zpräva o cinnosti tymu za rok 1966.
(s. 148)
230
20. 1967, 26. fijen, Praha. - Rozhovor redaktora Kulturni tvorby Vaclava
Kotka s vedoucim tynu Pavlem Machoninem, nazvany „Sociologicky
nezmapovany teren“. (s. 150)
21. 1967, 18. listopad, Praha. - Clänek Pavla Machonina „Znäme sami
sebe?“, uvefejneny v casopisu Svet v obrazech. (s. 155)
22. 1967, konec roku, Praha. - Podnik vypocetni techniky Statnimu sta-
tistickemu üfadu. Projekt zpracovani „velkeho“ a „maleho“ setfeni
socialni diferenciace a mobility obyvatelstva. (s. 160)
23. 1967, konec roku, Praha. - Vyrocni zpräva o cinnosti tymu
za rok 1967. (s. 165)
24. 1968, 7. bfezen, Praha. - LJvaha Pavla Machonina „Nova jednota spo-
lecnosti“, uvefejnenä v deniku Rude pravo.(s. 167)
25. 1969,16. leden, Praha. - Vyrocni zpräva o cinnosti tymu za rok 1968.
(s. 174)
26. 1970, 3. ünor, Praha. - Vyrocni zpräva o cinnosti tymu za rok 1969.
(s. 175)
Mlynáruv tym
(tyn pro rozvoj demokracie a politického systému nasi spolecnosti)
27. 1966, 26. fíjen, Praha. - Dopis Zdeñka Mlynáre tajemníkovi ÚV KSC
Vladimíru Kouckému s prosbou o uvolnéní z funkce tajemníka právní
komise ÚV KSC a s informací o první poradé s budoucími spolupra-
covníky. (s. 178)
28. 1966, konec roku, Praha. - Návrh Zdeñka Mlynáre na obsahové za-
méíení tymu v perspektivé 5-7 let. (s. 181)
29. 1967, 20. cervenec, Praha. - Úkoly a cíle úvodní fáze cinnosti tynu,
jez jsou spojovány s pfípravou XTV. sjezdu KSC. (s. 192)
30. 1967, 23. fíjen, Praha. - Zápis ze schúze rady tymu, v némz jsou ele-
nové tymu upozornéni na skutecnost, ze vysledky práce nelze publi-
kovat a propagovat nezávisle bez projednání stranickymi orgány.
(s. 194)
31. 1967, 31. fíjen, Tupadly. - Zápis ze schuze rady tymu, v némz je ozná-
meno schválení prüzkumu vefejného mínéní o hodnotovych orienta-
cích obyvatelstva vzhledem k dynamice politického systému. (s. 197)
32. 1967,1. listopad, Praha. - Vyrocní zpráva o cinnosti tymu za rok 1967
s pfedbéznym plánem práce na rok 1968. (s. 198)
231
33. 1967, konec roku, Praha. - Návrh koncepce prûzkumu nazvaného
„Postoje obyvatelstva ve vztahu k institucionální strukture“, v nëmz
vedouci tymu Zdenëk Mlynár objasñuje vychodiska a eile prûzkumu.
(s. 213)
34. 1968, 25. leden, Praha. - Polemicky pojaty komentár Zdeñka Mlyná-
fe k textu nazvanému „Studijní materiál o úloze NF a nëkteré nâmitky
k perspektivnimu vyvoji“, v nëmz v rámei prípravnych prací na Akc-
nim programu KSC doporucuje nepfijímat zádná samostatná poli-
tická rozhodnutí o otázkách Národní fronty, zvlásté co se tyká jejího
„oziveni“. (s. 215)
232
JMENNY REJSTRÍK
Alan, Josef 176
Auerhan, Jan 97
Bares, Gustav 103
Bärta, Drahomir 103,119
Bartäk 197
Bartos, E. 103,122
Becväf, Josef 194
Bell, Daniel 138
Benes, Edvard 190
Berlinguer, Enrico 126
Bertelmann, Karel 103,194,197,
200, 213
Bezouska, J. 160, 163
Bodnar, J. 103,122
Boguszak, Jin 197, 213
Bokorovä, V. 98
Bolina, J. 103
Brabec, F. 97
Brenner, V. 103
Brokl, Lubomir 176,194,197,198,
200, 201, 213
Brus, Wlodzimierz 48
Bystrina, Ivan 194,197,198, 209,
213
Cerroni, Umberto 126
Cini, Marcello 126
Cisar, Cestmir 99
Cvekl, Jin 80, 82, 90, 93, 98,103,
125
Cajovä, Anna 160,164
Cap 197
Cech, V. 148
Cerny, M. 99
Dlabaja 12
Drab, Zdenek 76, 90, 97,103
Dvorak 14
Dubcek, Alexander 97,103
Dubská, Irena 80, 82, 90, 91,103
Duda, E. 89, 97,103
Dziedzinská, Libuse 149,166,176
Engels, Bedrich 106
Fabián 197
Falfan, Samuel 197
Fedosjejev, P. N. 137
Fibich, Jindfich 98,194,197,198,
201, 213
Filipcová, Blanka 99,103
Filipec, Jindfich 76, 80, 82, 90, 93,
97,99,103,119,121,126,129-136
Filkus, R. 90,103
Fischer, J. 90,103
Fisera 194,197
Fiserová, Vlasta 121,176
Flechtheim, Ossip K. 79
Fornusek, Jaroslav 34
Fumi 126
Garaudy, Roger 81
Gottlieb, M. 99,103
Gottwald, Klement 82, 216
Grospic, Jin 194, 195, 197, 198,
209, 213
Habáñ, 194,196,197
Hájek, M. 85, 97,103
Hanzelka, J. 103
Hanzlicek 14
Havelka, J. 98,103
Havlícková, Marie 92,129
Havlínová 80
Herink, V. 98,103
Hermach, Jin 80, 98,103
Hodek, A. 80,103
Hodic, Josef 194,195, 209,213
222
Holy, Karel 166,174,177
Horák 81
Horák, Petr 102
Horák, R. 103
Horváthová, M. 103
Houska, Lubomir 200
Houska, J. 103
Hrouda, M. 103
Hÿsek, Jan 83
Chruscov, Nikita Sergejevic 21
Janis, Jindrich 39
Janousek, J. 98,103,120
Janovicovà, Jolana 176
Javurek, Zdenëk 81, 95,103
Jelinek, J. 174
Jiëinsky, Zdenëk 197,198, 201,
213
Jirásek, J. 98
Jodl, Miroslav 194, 197, 198, 201,
209,213
Jouvenel, de Bertrand 101,126
Jungk, Robert 76, 82, 90
Jungmann, Bohumil 98,103,176
Kalâb, Milos 148,194,197, 213
Kalenská, Marie 201
Kalinová, Lenka 177
Kalivoda 194
Kaplan, Karel 16,130,195,198,213
Kapr, Jaroslav 176
Kedrov, Bonifatij Michajlovic 101,
126,137
Klauco, J. 81, 87, 97,103
Klein, Ota 80, 81, 90, 91, 94, 98,
103,119,120,124
Klofâc, Jaroslav 166-168
Klokocka, Vladimir 200, 213
Knapp, Viktor 91,127,130,197
Kocanda, Rudolf 194,197,198,
200, 209, 213
Koctüch, Hvezdon 197
Kodet, Zdenek 28
Kohn, Pavel 176
Kolder, Drahomir 23, 27
Komenda, Bohumil 17
Koran, Josef93
Kosta, Jifi 97,103,120
Kostka 90
Kotacka 197
Kotäsek, J. 104
Kotek, Vaclav 70,150,155
Koucky, Vladimirl78,180 191
Kowalski, S. T. 205
Kozusnik, Cestmir 28, 54
Kral, Miroslav 81, 90, 93, 97, 103,
120,125
Kratochvil, Frantisek 194,197,213
Kraus 13
Kraus, Alois 36, 39
Kfizkovsky, Ladislav 200, 213
Kutta, Frantisek 90, 98, 103, 119,
121
Lakomy, Z. 99,103,120
Lamser, Vaclav 85,122
Lantay 197
Lenin, Vladimir Iljic 14, 67, 70,106
Levcik, Bedfich 75, 76, 90, 91, 97,
103,119,120
Levit, Pavel 194,197, 200, 213
Liberman 49
Linhart, Jifi
Löbl, Eugen 104
Loewenstein, Bedfich 99,104
Macek, Josef 99
Macüch, P. 99
Magdoien, E. 103
Machonin, Pavel 6, 98,104,144,
148-150,165,167,174-177
Markova, K. 104
223
Marx, Karel 65, 74,106,107,136,
206
Masaryk, Tomás Garriguel90
Maydl, Premysl 121,124
Medonos, S. 104
Mesthene, Emmanuel G. 101
Mikule, Vladimir 213
Minárik, K. 103,122
Mitin, Mark Borisovic 138
Mlynáí, Zdenëk 6,42,98,178,180,
181,191,194-199,213,215,221
Mrázek 13
Musil, Jiri 99,104,197
Nachtigal, V. 104
Nejedlÿ 15
Nekola, J. 97,104,119
Nëmcinov 49
Neri 126
Netopilik, Jakub 81
Novotny, Antonín 23,68
Novy, O. 99,103
Obzina, Jaromir 180
Opat, Jaroslav 201
Opatová 95
Orlicky, J. 89,104
Pachman, VI. 50
Pafr zek, V. 98,103,121
Pavlenda 197
Pavlicek, Václav 101
Pavlik, 0.98,103,122
Pergier, Premysl 122
Peäka, Pavel 194,197,201,209,213
Petrusek, Miloslav 149,176
Pithart, Petr 194,196-198,200,213
Plichta, Dalibor 200
Pluhaf, J. 97
Podoláková, Katarina 176
Pokornÿ, D. 104
Poupa. Otakar 104
Povolnÿ, Frantisek 176
Povondra, M. 104
Provaznik, S. 104
Prûcha, M. 80, 99,103
Prusa, 0.179
Prikryl, J. 89, 90
Prikryl, V. 98,104,119
Pücek 13
Richta, Radovan 6, 72, 80, 82, 90,
91, 94, 95, 97, 99, 103, 119, 126,
129-138,156,179,206,210
Rohan, René 221
Rollovâ, Vëra 176
Rosko, Robert 176
Ruml Vladimir 81
Riha, L. 104
Santi 126
Selucky, Radoslav 104
Schautovâ, D. 92
Skalina, P. 104
Skarzinskà, V126.
Slâma, J. 97,103
Slavik 194
Slucha, J. 149
Smazal 15
Smetana, Miroslav 87,94
Soucek, M. 97
Soukup, M. 194
Srovnal, Jindfich 81,104
Stejskal, Eugen 200
Strégl, K. 104
Strinka 197
Suchânek, Jaroslav 201
Sucharda 15
Svoboda, Milo§ 80,98,103, 213
Sychrovâ, H.98,104,121
Safâr, Zdenëk 176
Samalik, Frantisek 94,97,198,201,
213
224
Sik, Ota 34, 38, 39, 63, 71, 91, 97,
156
Simek 16
Sindeláí, Dusan 98
Sindeláí, J. 99,103,120
Smeral, Bohumir 190
Smidák, Miroslav 104,180
Sorm, Frantisek 81, 87, 91, 97, 99,
127,178-180
Stépanovsky, J. 121
Strégl, K. 98
Suchardin, Semen Viktorovic 126
Sulc, O. 121
Teich, Mikulás 99,104
Ter-Manulianc, A. 104
Tessmann, Kurt 81, 83,91,126
Timoféjev, T. 137
Tlusty, Vojtéch 166
Toman 14
Toms, M. 85, 97,104
Tomsová, Iva 200, 213
Tondi, Ladislav 76, 81, 90, 97, 103,
119,120
Trapeznikov 49
Trentin 126
Turek, Otakar 45, 55
Urban, L. 104
Vandas, Tomás 96
Vasecka, Felix 194,195,197, 213
Vecernik, Jin 176
Veselá, Milena 129
Vitásek 91
Vomácka, F. 121
Vrba, J. 99,103,121
Vrecion, Vladimir 200
Weinberger, Ota 194
Weiner, Bedrich 194, 197, 198,
201, 213
Zaorálková 194,197
Zeman 81
Zeman, Milos 121
Zemanek, Heinz 76, 82
Zelenÿ, Jindrich 81, 97,104
Zelinka, Jaroslav 160,164
Zoulik 180
Zdímal, M. 121
225
|
| any_adam_object | 1 |
| author | Hoppe, Jiří 1968- Škodová, Markéta Suk, Jiří 1966- Caccamo, Francesco ca. 20./21. Jh |
| author_GND | (DE-588)139866086 (DE-588)137899343 (DE-588)1246388197 |
| author_facet | Hoppe, Jiří 1968- Škodová, Markéta Suk, Jiří 1966- Caccamo, Francesco ca. 20./21. Jh |
| author_role | aut aut aut aut |
| author_sort | Hoppe, Jiří 1968- |
| author_variant | j h jh m š mš j s js f c fc |
| building | Verbundindex |
| bvnumber | BV044617778 |
| classification_rvk | NK 2470 NQ 8273 |
| ctrlnum | (OCoLC)1015871262 (DE-599)BSZ493542981 |
| discipline | Geschichte |
| era | Geschichte 1960-1970 gnd |
| era_facet | Geschichte 1960-1970 |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>03763nam a2200637 cb4500</leader><controlfield tag="001">BV044617778</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20211124 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">171108s2016 m||| 00||| cze d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9788072852017</subfield><subfield code="9">978-80-7285-201-7</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1015871262</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BSZ493542981</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">cze</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-739</subfield><subfield code="a">DE-12</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">OST</subfield><subfield code="q">DE-12</subfield><subfield code="2">fid</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">NK 2470</subfield><subfield code="0">(DE-625)125896:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">NQ 8273</subfield><subfield code="0">(DE-625)128968:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Hoppe, Jiří</subfield><subfield code="d">1968-</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)139866086</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">"O nový československý model socialismu"</subfield><subfield code="b">edice dokumentů ke čtyřem interdisciplinárním vědeckým týmům při ČSAV a UK v 60. letech = "Striving for a new Czechoslovak model of socialism" : edition of documents on four interdisciplinary scientific teams of the Czechoslovak Academy of Sciences and the Charles University in the 1960s</subfield><subfield code="c">Jiří Hoppe, Markéta Škodová, Jiří Suk, Francesco Caccamo</subfield></datafield><datafield tag="246" ind1="1" ind2="1"><subfield code="a">"Striving for a new Czechoslovak model of socialism"</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Praha</subfield><subfield code="b">Ústav pro soudobé dějiny AV ČR, v.v.i.</subfield><subfield code="c">2016</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">236 Seiten</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Sešity Ústavu pro soudobé dějiny</subfield><subfield code="v">sv. 50</subfield></datafield><datafield tag="546" ind1=" " ind2=" "><subfield code="a">Zusammenfassung auf Englisch</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte 1960-1970</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Politische Wissenschaft</subfield><subfield code="0">(DE-588)4076229-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Sozialismus</subfield><subfield code="0">(DE-588)4055785-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Sozialwissenschaften</subfield><subfield code="0">(DE-588)4055916-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Wirtschaftswissenschaften</subfield><subfield code="0">(DE-588)4066528-8</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Tschechoslowakei</subfield><subfield code="0">(DE-588)4078435-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)4135952-5</subfield><subfield code="a">Quelle</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Tschechoslowakei</subfield><subfield code="0">(DE-588)4078435-6</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Sozialismus</subfield><subfield code="0">(DE-588)4055785-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Wirtschaftswissenschaften</subfield><subfield code="0">(DE-588)4066528-8</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Sozialwissenschaften</subfield><subfield code="0">(DE-588)4055916-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="4"><subfield code="a">Politische Wissenschaft</subfield><subfield code="0">(DE-588)4076229-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="5"><subfield code="a">Geschichte 1960-1970</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Škodová, Markéta</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Suk, Jiří</subfield><subfield code="d">1966-</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)137899343</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Caccamo, Francesco</subfield><subfield code="d">ca. 20./21. Jh.</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1246388197</subfield><subfield code="4">aut</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Sešity Ústavu pro soudobé dějiny</subfield><subfield code="v">sv. 50</subfield><subfield code="w">(DE-604)BV010182532</subfield><subfield code="9">50</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HEBIS Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030016111&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030016111&sequence=000006&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Abstract</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030016111&sequence=000007&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Literaturverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030016111&sequence=000008&line_number=0004&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Register // Personenregister</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">oe</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-030016111</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">909</subfield><subfield code="e">22/bsb</subfield><subfield code="f">0904</subfield><subfield code="g">437</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">330.09</subfield><subfield code="e">22/bsb</subfield><subfield code="f">0904</subfield><subfield code="g">437</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">306.09</subfield><subfield code="e">22/bsb</subfield><subfield code="f">0904</subfield><subfield code="g">437</subfield></datafield></record></collection> |
| genre | (DE-588)4135952-5 Quelle gnd-content |
| genre_facet | Quelle |
| geographic | Tschechoslowakei (DE-588)4078435-6 gnd |
| geographic_facet | Tschechoslowakei |
| id | DE-604.BV044617778 |
| illustrated | Not Illustrated |
| indexdate | 2024-07-10T07:57:16Z |
| institution | BVB |
| isbn | 9788072852017 |
| language | Czech |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-030016111 |
| oclc_num | 1015871262 |
| open_access_boolean | |
| owner | DE-739 DE-12 |
| owner_facet | DE-739 DE-12 |
| physical | 236 Seiten |
| publishDate | 2016 |
| publishDateSearch | 2016 |
| publishDateSort | 2016 |
| publisher | Ústav pro soudobé dějiny AV ČR, v.v.i. |
| record_format | marc |
| series | Sešity Ústavu pro soudobé dějiny |
| series2 | Sešity Ústavu pro soudobé dějiny |
| spelling | Hoppe, Jiří 1968- Verfasser (DE-588)139866086 aut "O nový československý model socialismu" edice dokumentů ke čtyřem interdisciplinárním vědeckým týmům při ČSAV a UK v 60. letech = "Striving for a new Czechoslovak model of socialism" : edition of documents on four interdisciplinary scientific teams of the Czechoslovak Academy of Sciences and the Charles University in the 1960s Jiří Hoppe, Markéta Škodová, Jiří Suk, Francesco Caccamo "Striving for a new Czechoslovak model of socialism" Praha Ústav pro soudobé dějiny AV ČR, v.v.i. 2016 236 Seiten txt rdacontent n rdamedia nc rdacarrier Sešity Ústavu pro soudobé dějiny sv. 50 Zusammenfassung auf Englisch Geschichte 1960-1970 gnd rswk-swf Politische Wissenschaft (DE-588)4076229-4 gnd rswk-swf Sozialismus (DE-588)4055785-6 gnd rswk-swf Sozialwissenschaften (DE-588)4055916-6 gnd rswk-swf Wirtschaftswissenschaften (DE-588)4066528-8 gnd rswk-swf Tschechoslowakei (DE-588)4078435-6 gnd rswk-swf (DE-588)4135952-5 Quelle gnd-content Tschechoslowakei (DE-588)4078435-6 g Sozialismus (DE-588)4055785-6 s Wirtschaftswissenschaften (DE-588)4066528-8 s Sozialwissenschaften (DE-588)4055916-6 s Politische Wissenschaft (DE-588)4076229-4 s Geschichte 1960-1970 z DE-604 Škodová, Markéta Verfasser aut Suk, Jiří 1966- Verfasser (DE-588)137899343 aut Caccamo, Francesco ca. 20./21. Jh. Verfasser (DE-588)1246388197 aut Sešity Ústavu pro soudobé dějiny sv. 50 (DE-604)BV010182532 50 HEBIS Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030016111&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis Digitalisierung BSB München 19 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030016111&sequence=000006&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA Abstract Digitalisierung BSB München 19 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030016111&sequence=000007&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA Literaturverzeichnis Digitalisierung BSB München 19 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030016111&sequence=000008&line_number=0004&func_code=DB_RECORDS&service_type=MEDIA Register // Personenregister |
| spellingShingle | Hoppe, Jiří 1968- Škodová, Markéta Suk, Jiří 1966- Caccamo, Francesco ca. 20./21. Jh "O nový československý model socialismu" edice dokumentů ke čtyřem interdisciplinárním vědeckým týmům při ČSAV a UK v 60. letech = "Striving for a new Czechoslovak model of socialism" : edition of documents on four interdisciplinary scientific teams of the Czechoslovak Academy of Sciences and the Charles University in the 1960s Sešity Ústavu pro soudobé dějiny Politische Wissenschaft (DE-588)4076229-4 gnd Sozialismus (DE-588)4055785-6 gnd Sozialwissenschaften (DE-588)4055916-6 gnd Wirtschaftswissenschaften (DE-588)4066528-8 gnd |
| subject_GND | (DE-588)4076229-4 (DE-588)4055785-6 (DE-588)4055916-6 (DE-588)4066528-8 (DE-588)4078435-6 (DE-588)4135952-5 |
| title | "O nový československý model socialismu" edice dokumentů ke čtyřem interdisciplinárním vědeckým týmům při ČSAV a UK v 60. letech = "Striving for a new Czechoslovak model of socialism" : edition of documents on four interdisciplinary scientific teams of the Czechoslovak Academy of Sciences and the Charles University in the 1960s |
| title_alt | "Striving for a new Czechoslovak model of socialism" |
| title_auth | "O nový československý model socialismu" edice dokumentů ke čtyřem interdisciplinárním vědeckým týmům při ČSAV a UK v 60. letech = "Striving for a new Czechoslovak model of socialism" : edition of documents on four interdisciplinary scientific teams of the Czechoslovak Academy of Sciences and the Charles University in the 1960s |
| title_exact_search | "O nový československý model socialismu" edice dokumentů ke čtyřem interdisciplinárním vědeckým týmům při ČSAV a UK v 60. letech = "Striving for a new Czechoslovak model of socialism" : edition of documents on four interdisciplinary scientific teams of the Czechoslovak Academy of Sciences and the Charles University in the 1960s |
| title_full | "O nový československý model socialismu" edice dokumentů ke čtyřem interdisciplinárním vědeckým týmům při ČSAV a UK v 60. letech = "Striving for a new Czechoslovak model of socialism" : edition of documents on four interdisciplinary scientific teams of the Czechoslovak Academy of Sciences and the Charles University in the 1960s Jiří Hoppe, Markéta Škodová, Jiří Suk, Francesco Caccamo |
| title_fullStr | "O nový československý model socialismu" edice dokumentů ke čtyřem interdisciplinárním vědeckým týmům při ČSAV a UK v 60. letech = "Striving for a new Czechoslovak model of socialism" : edition of documents on four interdisciplinary scientific teams of the Czechoslovak Academy of Sciences and the Charles University in the 1960s Jiří Hoppe, Markéta Škodová, Jiří Suk, Francesco Caccamo |
| title_full_unstemmed | "O nový československý model socialismu" edice dokumentů ke čtyřem interdisciplinárním vědeckým týmům při ČSAV a UK v 60. letech = "Striving for a new Czechoslovak model of socialism" : edition of documents on four interdisciplinary scientific teams of the Czechoslovak Academy of Sciences and the Charles University in the 1960s Jiří Hoppe, Markéta Škodová, Jiří Suk, Francesco Caccamo |
| title_short | "O nový československý model socialismu" |
| title_sort | o novy ceskoslovensky model socialismu edice dokumentu ke ctyrem interdisciplinarnim vedeckym tymum pri csav a uk v 60 letech striving for a new czechoslovak model of socialism edition of documents on four interdisciplinary scientific teams of the czechoslovak academy of sciences and the charles university in the 1960s |
| title_sub | edice dokumentů ke čtyřem interdisciplinárním vědeckým týmům při ČSAV a UK v 60. letech = "Striving for a new Czechoslovak model of socialism" : edition of documents on four interdisciplinary scientific teams of the Czechoslovak Academy of Sciences and the Charles University in the 1960s |
| topic | Politische Wissenschaft (DE-588)4076229-4 gnd Sozialismus (DE-588)4055785-6 gnd Sozialwissenschaften (DE-588)4055916-6 gnd Wirtschaftswissenschaften (DE-588)4066528-8 gnd |
| topic_facet | Politische Wissenschaft Sozialismus Sozialwissenschaften Wirtschaftswissenschaften Tschechoslowakei Quelle |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030016111&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030016111&sequence=000006&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030016111&sequence=000007&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030016111&sequence=000008&line_number=0004&func_code=DB_RECORDS&service_type=MEDIA |
| volume_link | (DE-604)BV010182532 |
| work_keys_str_mv | AT hoppejiri onovyceskoslovenskymodelsocialismuedicedokumentukectyreminterdisciplinarnimvedeckymtymumpricsavaukv60letechstrivingforanewczechoslovakmodelofsocialismeditionofdocumentsonfourinterdisciplinaryscientificteamsoftheczechoslovakacademyofsciencesandthecharlesun AT skodovamarketa onovyceskoslovenskymodelsocialismuedicedokumentukectyreminterdisciplinarnimvedeckymtymumpricsavaukv60letechstrivingforanewczechoslovakmodelofsocialismeditionofdocumentsonfourinterdisciplinaryscientificteamsoftheczechoslovakacademyofsciencesandthecharlesun AT sukjiri onovyceskoslovenskymodelsocialismuedicedokumentukectyreminterdisciplinarnimvedeckymtymumpricsavaukv60letechstrivingforanewczechoslovakmodelofsocialismeditionofdocumentsonfourinterdisciplinaryscientificteamsoftheczechoslovakacademyofsciencesandthecharlesun AT caccamofrancesco onovyceskoslovenskymodelsocialismuedicedokumentukectyreminterdisciplinarnimvedeckymtymumpricsavaukv60letechstrivingforanewczechoslovakmodelofsocialismeditionofdocumentsonfourinterdisciplinaryscientificteamsoftheczechoslovakacademyofsciencesandthecharlesun AT hoppejiri strivingforanewczechoslovakmodelofsocialism AT skodovamarketa strivingforanewczechoslovakmodelofsocialism AT sukjiri strivingforanewczechoslovakmodelofsocialism AT caccamofrancesco strivingforanewczechoslovakmodelofsocialism |