The evolution of pragmatic markers in English: pathways of change
Gespeichert in:
| Format: | Buch |
|---|---|
| Sprache: | English |
| Veröffentlicht: |
Cambridge, United Kingdom
Cambridge University Press
2017
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | xiv, 331 Seiten Diagramme |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV044489847 | ||
| 003 | DE-604 | ||
| 005 | 20220329 | ||
| 007 | t | ||
| 008 | 170915s2017 |||| |||| 00||| eng d | ||
| 020 | |z 9781107129054 |c Hardback |9 978-1-107-12905-4 | ||
| 035 | |a (OCoLC)1007806735 | ||
| 035 | |a (DE-599)BVBBV044489847 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-20 |a DE-384 |a DE-11 |a DE-703 |a DE-739 |a DE-355 |a DE-19 | ||
| 084 | |a HF 350 |0 (DE-625)48882: |2 rvk | ||
| 245 | 1 | 0 | |a The evolution of pragmatic markers in English |b pathways of change |c Laurel J. Brinton, University of British Columbia |
| 264 | 1 | |a Cambridge, United Kingdom |b Cambridge University Press |c 2017 | |
| 300 | |a xiv, 331 Seiten |b Diagramme | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 650 | 0 | 7 | |a Englisch |0 (DE-588)4014777-0 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Diskursmarker |0 (DE-588)4304342-2 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Sprachwandel |0 (DE-588)4056508-7 |2 gnd |9 rswk-swf |
| 689 | 0 | 0 | |a Englisch |0 (DE-588)4014777-0 |D s |
| 689 | 0 | 1 | |a Diskursmarker |0 (DE-588)4304342-2 |D s |
| 689 | 0 | 2 | |a Sprachwandel |0 (DE-588)4056508-7 |D s |
| 689 | 0 | |5 DE-604 | |
| 700 | 1 | |a Brinton, Laurel J. |d 1953- |e Sonstige |0 (DE-588)138801924 |4 oth | |
| 776 | 0 | 8 | |i Erscheint auch als |n Online-Ausgabe |z 978-1-316-41601-3 |
| 856 | 4 | 2 | |m Digitalisierung UB Augsburg - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029889829&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-029889829 | ||
Datensatz im Suchindex
| _version_ | 1804177833885433856 |
|---|---|
| adam_text | Contents
List of Figures
List of Tables
Preface
List of Abbreviations
1 Pragmatic Markers: Synchronic and Diachronic
1.1 Introduction
1.2 Pragmatic Markers: Definition and Functions
1.3 Problems for the Diachronic Study of Pragmatic Markers
1.4 Pathways for the Development of Pragmatic Markers
1.5 Processes of Change
1.6 Contents and Organization of the Book
Part I From Lexical Item to Pragmatic Marker
2 Old English Hwcet
2.1 Introduction
2.2 Hwcet as an Interjection
2.3 Exclamatory Hwcet in Verse
2.4 Exclamatory Hwcet in Prose
2.5 Combinations of Hwcet with Inteijections
2.6 Later History of Exclamatory What
2.7 The Development of What
2.8 Conclusion
3 Middle English Whilom
3.1 Introduction
3.2 Traugott’s Account of While
3.3 The Evolution of Whilom
3.4 Accounting for the Change
3.5 Conclusion
4 Modern English Only and If Only
4.1 Introduction
4.2 Conjunctive Only in Present-Day English
4.3 The Development of Only
page viii
ix
xi
xiii
1
1
2
12
13
26
37
41
41
42
46
56
62
64
69
73
75
75
76
78
88
95
97
97
98
104
vi Contents
4.4 If Only 114
4.5 Conclusion 122
Part II From Clausal Construction to Pragmatic Marker 125
5 Epistemic Parentheticals 127
5.1 Introduction 127
5.2 First-Person Epistemic Parentheticals in Present-Day English 129
5.3 The History of Epistemic Parentheticals: Review of Previous Studies 135
5.4 Epistemic Marking in Middle English 138
5.5 First-Person Epistemic Parentheticals in Chaucer 145
5.6 Development of First-Person Epistemic Parentheticals 153
5.7 Conclusion 167
6 I/You Admit and Admittedly 168
6.1 Introduction 168
6.2 Admit in Present-Day English 169
6.3 Admittedly in Present-Day English 173
6.4 Synchronic Correspondences 175
6.5 Postulated Developments 177
6.6 Historical Evidence for the Rise of I/You Admit and Admittedly 179
6.7 Discussion 186
6.8 Conclusion 189
7 Forms of Say : That Said and Fm Just Saying 191
7.1 Introduction 191
7.2 The ‘‘That Said” Construction 192
7.3 (I’m) Just Saying and Related Comment Clauses 206
7.4 Conclusion 226
8 Two Politeness Parentheticals: If I May Say So and
For What It s Worth 229
8.1 Introduction 229
8.2 If I May/Might Say So 232
8.3 For What It s Worth 240
8.4 Conclusion 250
9 What s More and Whatever 251
9.1 Introduction 251
9.2 What’s More in Present-Day English 252
9.3 The History of What’s More and Related Constructions 256
9.4 Accounting for the Development of the What’s More Construction 266
9.5 Whatever in Present-Day English 268
9.6 Origin and History of the Pragmatic Marker Whatever 272
9.7 Conclusion 282
10 Concluding Remarks: Pathways of Change 284
10.1 Introduction 284
10.2 Adverbial Sources of Pragmatic Markers 285
Contents vii
10.3 Clausal Sources of Pragmatic Markers 287
10.4 The Rise of Disjunct Ad verbials 294
10.5 Envoi 295
Appendix: Corpora and Text Collections 298
References 300
Author Index 325
Subject Index 329
|
| any_adam_object | 1 |
| author_GND | (DE-588)138801924 |
| building | Verbundindex |
| bvnumber | BV044489847 |
| classification_rvk | HF 350 |
| ctrlnum | (OCoLC)1007806735 (DE-599)BVBBV044489847 |
| discipline | Anglistik / Amerikanistik |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01649nam a2200373 c 4500</leader><controlfield tag="001">BV044489847</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20220329 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">170915s2017 |||| |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">9781107129054</subfield><subfield code="c">Hardback</subfield><subfield code="9">978-1-107-12905-4</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1007806735</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV044489847</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-20</subfield><subfield code="a">DE-384</subfield><subfield code="a">DE-11</subfield><subfield code="a">DE-703</subfield><subfield code="a">DE-739</subfield><subfield code="a">DE-355</subfield><subfield code="a">DE-19</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">HF 350</subfield><subfield code="0">(DE-625)48882:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">The evolution of pragmatic markers in English</subfield><subfield code="b">pathways of change</subfield><subfield code="c">Laurel J. Brinton, University of British Columbia</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Cambridge, United Kingdom</subfield><subfield code="b">Cambridge University Press</subfield><subfield code="c">2017</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">xiv, 331 Seiten</subfield><subfield code="b">Diagramme</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Englisch</subfield><subfield code="0">(DE-588)4014777-0</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Diskursmarker</subfield><subfield code="0">(DE-588)4304342-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Sprachwandel</subfield><subfield code="0">(DE-588)4056508-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Englisch</subfield><subfield code="0">(DE-588)4014777-0</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Diskursmarker</subfield><subfield code="0">(DE-588)4304342-2</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Sprachwandel</subfield><subfield code="0">(DE-588)4056508-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Brinton, Laurel J.</subfield><subfield code="d">1953-</subfield><subfield code="e">Sonstige</subfield><subfield code="0">(DE-588)138801924</subfield><subfield code="4">oth</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Online-Ausgabe</subfield><subfield code="z">978-1-316-41601-3</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Augsburg - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029889829&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-029889829</subfield></datafield></record></collection> |
| id | DE-604.BV044489847 |
| illustrated | Not Illustrated |
| indexdate | 2024-07-10T07:54:22Z |
| institution | BVB |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-029889829 |
| oclc_num | 1007806735 |
| open_access_boolean | |
| owner | DE-20 DE-384 DE-11 DE-703 DE-739 DE-355 DE-BY-UBR DE-19 DE-BY-UBM |
| owner_facet | DE-20 DE-384 DE-11 DE-703 DE-739 DE-355 DE-BY-UBR DE-19 DE-BY-UBM |
| physical | xiv, 331 Seiten Diagramme |
| publishDate | 2017 |
| publishDateSearch | 2017 |
| publishDateSort | 2017 |
| publisher | Cambridge University Press |
| record_format | marc |
| spelling | The evolution of pragmatic markers in English pathways of change Laurel J. Brinton, University of British Columbia Cambridge, United Kingdom Cambridge University Press 2017 xiv, 331 Seiten Diagramme txt rdacontent n rdamedia nc rdacarrier Englisch (DE-588)4014777-0 gnd rswk-swf Diskursmarker (DE-588)4304342-2 gnd rswk-swf Sprachwandel (DE-588)4056508-7 gnd rswk-swf Englisch (DE-588)4014777-0 s Diskursmarker (DE-588)4304342-2 s Sprachwandel (DE-588)4056508-7 s DE-604 Brinton, Laurel J. 1953- Sonstige (DE-588)138801924 oth Erscheint auch als Online-Ausgabe 978-1-316-41601-3 Digitalisierung UB Augsburg - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029889829&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | The evolution of pragmatic markers in English pathways of change Englisch (DE-588)4014777-0 gnd Diskursmarker (DE-588)4304342-2 gnd Sprachwandel (DE-588)4056508-7 gnd |
| subject_GND | (DE-588)4014777-0 (DE-588)4304342-2 (DE-588)4056508-7 |
| title | The evolution of pragmatic markers in English pathways of change |
| title_auth | The evolution of pragmatic markers in English pathways of change |
| title_exact_search | The evolution of pragmatic markers in English pathways of change |
| title_full | The evolution of pragmatic markers in English pathways of change Laurel J. Brinton, University of British Columbia |
| title_fullStr | The evolution of pragmatic markers in English pathways of change Laurel J. Brinton, University of British Columbia |
| title_full_unstemmed | The evolution of pragmatic markers in English pathways of change Laurel J. Brinton, University of British Columbia |
| title_short | The evolution of pragmatic markers in English |
| title_sort | the evolution of pragmatic markers in english pathways of change |
| title_sub | pathways of change |
| topic | Englisch (DE-588)4014777-0 gnd Diskursmarker (DE-588)4304342-2 gnd Sprachwandel (DE-588)4056508-7 gnd |
| topic_facet | Englisch Diskursmarker Sprachwandel |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029889829&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT brintonlaurelj theevolutionofpragmaticmarkersinenglishpathwaysofchange |