Len čas musel dozrieť ...: osudy pozostalosti Milana Rastislava Štefánika = Waiting for the right time ... : the fate of Milan Rastislav Štefánik's estate = En attendant le bon moment ... : le sort du patrimoine de Milan Rastislav Štefánik
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | Slovak |
| Veröffentlicht: |
Bratislava
Slovenské národné múzeum
2017
|
| Ausgabe: | 1. vydanie |
| Schriftenreihe: | Museion
2. zväzok |
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis Abstract Literaturverzeichnis |
| Beschreibung: | 219 Seiten Faksimiles, Porträts |
| ISBN: | 9788080603953 |
Internformat
MARC
| LEADER | 00000nam a2200000 cb4500 | ||
|---|---|---|---|
| 001 | BV044414774 | ||
| 003 | DE-604 | ||
| 005 | 20180927 | ||
| 007 | t | ||
| 008 | 170718s2017 c||| |||| 00||| slo d | ||
| 020 | |a 9788080603953 |9 978-80-8060-395-3 | ||
| 035 | |a (OCoLC)1002250609 | ||
| 035 | |a (DE-599)BVBBV044414774 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a slo | |
| 049 | |a DE-12 | ||
| 084 | |a OST |q DE-12 |2 fid | ||
| 100 | 1 | |a Králiková, Eva |d ca. 20./21. Jh. |e Verfasser |0 (DE-588)1136925856 |4 aut | |
| 245 | 1 | 0 | |a Len čas musel dozrieť ... |b osudy pozostalosti Milana Rastislava Štefánika = Waiting for the right time ... : the fate of Milan Rastislav Štefánik's estate = En attendant le bon moment ... : le sort du patrimoine de Milan Rastislav Štefánik |c Eva Králiková |
| 246 | 1 | 1 | |a Waiting for the right time ... |
| 246 | 1 | 1 | |a En attendant le bon moment ... |
| 250 | |a 1. vydanie | ||
| 264 | 1 | |a Bratislava |b Slovenské národné múzeum |c 2017 | |
| 300 | |a 219 Seiten |b Faksimiles, Porträts | ||
| 336 | |b txt |2 rdacontent | ||
| 336 | |b sti |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 1 | |a Museion |v 2. zväzok | |
| 546 | |a Zusammenfassungen in englischer und französischer Sprache | ||
| 600 | 1 | 7 | |a Štefánik, Milan Rastislav |d 1880-1919 |0 (DE-588)119070847 |2 gnd |9 rswk-swf |
| 689 | 0 | 0 | |a Štefánik, Milan Rastislav |d 1880-1919 |0 (DE-588)119070847 |D p |
| 689 | 0 | |5 DE-604 | |
| 710 | 2 | |a Slovenské národné múzeum |0 (DE-588)1008388-1 |4 isb | |
| 830 | 0 | |a Museion |v 2. zväzok |w (DE-604)BV044365678 |9 2 | |
| 856 | 4 | 2 | |m Digitalisierung BSB München 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029816494&sequence=000004&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 856 | 4 | 2 | |m Digitalisierung BSB München 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029816494&sequence=000005&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |3 Abstract |
| 856 | 4 | 2 | |m Digitalisierung BSB München 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029816494&sequence=000006&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA |3 Literaturverzeichnis |
| 940 | 1 | |n oe | |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-029816494 | ||
| 942 | 1 | 1 | |c 909 |e 22/bsb |f 09041 |g 437 |
| 942 | 1 | 1 | |c 929 |e 22/bsb |f 09041 |g 4373 |
| 942 | 1 | 1 | |c 929 |e 22/bsb |f 09034 |g 4373 |
Datensatz im Suchindex
| _version_ | 1804177706160488448 |
|---|---|
| adam_text | 7
15
21
33
39
53
55
61
69
73
77
83
85
97
105
107
112
113
117
125
157
189
190
190
191
191
192
193
196
206
209
212
214
217
218
219
Obsah
Na uvod
Osudy pozostalosti M. R. Stefanika
1. Obdobie po tragickej smrti 4. maja 1919
2. Predmety z tragickej nehody 4. maja 1919
3. Konecne doma
(Slovenske narodne muzeum, Turciansky Sv. Martin)
Struktura fondu
1. Pisomnosti
2. Fotograficky material
3. Kniznica (knizne fondy)
4. Trojrozmerny material
Sucasti interieru bytu M. R. Stefanika
Predmety osobnej potreby
Predmety dokumentujuce osobne zaluby a zaujmy M. R. Stefanika
Prirodovedna, iluzionisticka a numizmaticka zbierka
Pristroje a nastroje M. R. Stefanika sluziace k jeho yedeckym vyskumom
Uniformy M. R. Stefanika, sucasti jeho vojenskej vystroje a vyzbroje
Pamiatky na smrf M. R. Stefanika
Navrhy zastav, vypracovane M. R. Stefanikom
Zaver
Zoznam identifikovanych predmetov
Obrazova priloha
Slovenske narodne muzeum v Martine
Slovenske narodne muzeum-Historicke muzeum Bratislava
Slovenske narodne muzeum-Prirodovedne muzeum Bratislava
Slovenske narodne muzeum-Muzeum Slovenskych narodnych rad Myjava
Vychodoslovenske muzeum Kosice
Muzeum Spisa v Spisskej Novej Vsi
Slovenske technicke muzeum Kosice
Balneologicke muzeum Piest’any
Poznamkovy aparat
Summary
Resume
Podakovanie autora
Literatura
Archivne pramene
Zbierkove fondy
Autori a zdroje fotografu a skenov
Eva Kralikova
Waiting for the right time...
The fate of Milan Rastislav
Stefanik’s estate
Summary
This publication is a first attempt to provide a more detailed view of the fate and current
situation of Milan Rastislav Stefaniks estate after its transfer to the first Czechoslovak
Republic. After its owner s tragic death, his estate remained in Paris at Rue Leclerc no.
6, in the sealed flat inhabited by Stefanik (the furnishings of the flat). The first people
to visit it were his brothers Ladislav and Igor (1919), followed by his sister Elena and his
brother Kazimir (1920) who drew up the first, incomplete lists. The fate of the estate on
its arrival in the republic, and subsequently, was as complicated as the fate of its owner.
After its importation in 1920 (Prague), it was temporarily placed in the Memorial to
the Resistance, finally becoming in 1928 part of the exhibition of the Memorial to the
Liberation in Prague. Difficult negotiations between M. R. Stefaniks family and the
government preceded a definitive solution, when it became the property of the state;
not only was the financial side of evaluating the estate as a whole crucial, but also the
question of its further use. Originally, the family insisted on its return to Slovakia and
the establishing of a commemorative museum. Later, it accepted its purchase by the
state. In the end, the family was not satisfied by the amount paid following the
evaluation, which was eventually agreed at 1 million 250 thousand Czechoslovak crowns.
Discrepancies concerning the final amount paid continued over the following decades,
arousing much interest in the Slovak autonomist press in particular. The remains from
M. R. Stefanik s tragic accident (debris of the airplane, destroyed clothing of the other
three people on board) also met an interesting fate. Even after their temporary storage
in Bratislava, their fate was not enviable: as a result of the poorly protected premises
of the government building (thefts), they were gradually integrated into the rest of the
collection of the Memorial to the Liberation in Prague.
After the establishment of the independent Slovak State (1939) efforts increased
to return the artefacts to Slovakia, particularly thanks to the Slovak National Museum
in Martin, which was preparing at the time the first nationwide exhibition in the newly-
built museum building (1929 - 1932). Their efforts came to a successful conclusion in
1940, when the Slovak government became involved in the problem and the estate was
first transferred to Bratislava, and then to the SNM in Martin with great ceremony.
Here, the major part of it found its place in a worthy exhibition dedicated to M. R.
206
Stefanik. This successful presentation was very popular among visitors. For the first
time, it showed the interior of his Parisian flat using authentic artefacts. As a result
of the changed political situation in the 1950s and 1960s, when M. R. Stefaniks name
was erased from national history, the exhibition had to be uninstalled after almost ten
years, and the exhibits were stored for a long time as taboo in the museum’s depositories.
The whole estate became the subject of political, not scholarly, decisions, following the
unfortunate fate of its owner. Its testimonial value was silenced over a long period. At
the end of the 1950s and in the first half of the 1960s the collection was unfortunately
moved around, which significantly and unfavourably affected its integrity. Specialised
collections from M. R. Stefaniks estate had to be divided up among several collections,
thus breaking up their natural integrity and their authentic testimonial value in
particular. The book collections, written documents, individual items of furniture,
technical artefacts and the natural science collections were divided up. Positive changes
took place only after 1990, when M. R. Stefanik s name was once more restored to our
history; historians, politicians and staff in the organisations where his collections were
stored took an interest in his fate and presentation. New exhibitions were opened in
the house where M. R. Stefanik was born in Kosariska (SNM - Museum of the Slovak
National Councils in Myjava) and several projects were prepared for the premieres of
exhibitions trying to give a true interpretation of the fate of this national hero. The basis
for these was the most authentic material: his as then little known possessions stored
in the collections of museums and archives. The wealth of written and photographic
documents, the testimonial value of the three-dimensional personal artefacts could thus
give a true interpretation of their owner. The staff of the Slovak National Museum in
Martin and Bratislava in particular were faced with a difficult task: almost one century
later to restore to its original state the estate based on preserved archive materials and
documentary records. It was complicated due to the very fragmented, imprecise period
data, from the original inventory of the collection on its arrival in Prague (1920 - 1921),
then after its transfer to Slovakia and in particular after its moves from the Slovak
National Museum to other collections in the 1960s. The present publication is thus the
result of this research, with information on the origins of the estate and a summary of
what we have been able to ascertain and identify. It also provides information on where
M. R. Stefanik’s collections can be found at present. For the main part, they are in the
Slovak National Museum in Martin (exotic artefacts, personal souvenirs, photographs),
with some parts in the collections of the SNM Museum of History in Bratislava, the
SNM Natural History Museum in Bratislava (where the collections linked to natural
science were moved), the Slovak National Library in Martin (book collections), the
Slovak National Archives in Bratislava (personal archive including a rich collection of
photographs), the Museum of Eastern Slovakia in Kosice (furniture) and the Technical
Museum in Kosice (technical artefacts). A considerable part of the estate from the
collections is at present in the M. R. Stefanik memorial exhibition in Kosariska - part
of the SNM Museum of the Slovak National Councils in Myjava (2005, 2015). An
important number of personal items donated by M. R. Stefaniks relatives in 1933 are in
207
the collections of the Museum of Balneology in Piesfany. The unique collection of art by
Paul Gauguin, which was part of his estate, never returned to Slovakia; it remained the
property of the National Gallery in Prague. The range of the original inventories (Prague,
Martin) and their documentary imperfections compared to the actual physical state
rendered identification difficult. It was also made difficult by inappropriate treatment
of the collections, which was the result of politicised state interventions affecting not
only their owner but also the artefacts that he left us. Today, almost one hundred years
after M. R. Stefanik s death, it is still assumed that many unidentified individual objects
(mainly from the tragic accident) are located in other collections, not only within
Slovakia, but also abroad, and perhaps even in private hands.
Several chapters deal with the structure of the collection. They are arranged by
type of material into two-dimensional (writings, photographic material, books) and
three-dimensional artefacts (items from the interior of M. R. Stefanik s flat, personal
items, items documenting M. R. Stefanik s personal hobbies and interests, natural
science artefacts and an illusionist and a numismatic collection, scientific aids, uniforms,
souvenirs from his tragic death and a collection of designs for flags designed by
M.R. Stefanik) which make up the longest chapters. Each chapter includes an annexe with
a published catalogue of the collections by museums currently housing M. R. Stefanik s
collections and describes in brief the relevant collection, its fate and its acquisition by
M. R. Stefanik. The catalogues summarise the collection in the Slovak National Museum
in Martin (the major part of the estate: personal items, collection mainly of exotic
artefacts, photographs), the SNM Museum of History in Bratislava (collections donated
by the family during the preparation of the first memorial exhibition at Kosariska),
the SNM Natural Science Museum in Bratislava (assigned natural history collections),
the Museum of Eastern Slovakia in Kosice and the Museum in Markusovce (assigned
furniture items, today in the exhibitions in Kosariska), the Technical Museum in
Kosice (assigned technical artefacts). The personal items deposited in the Balneological
Museum in Piesfany are summarized. The archive material (writings, photographs)
which was assigned to the Slovak National Archives in Bratislava is accessible thanks to
a well drawn up inventory, as is the list of books stored in the Slovak National Library
in Martin.
A wide-ranging chapter includes annexe of photographs (exotic artefacts and
personal items from the collections of the SNM in Martin, views of the exhibitions in
Kosariska and Piesfany), notes, bibliography, archive sources used for research as well as
a list of institutions where the collections from M. R. Stefaniks estate can be found. Due
to the complexity of the work involved in identifying M. R. Stefaniks collections stored
in several collections and since a large number of experts and colleagues participated
in the task, thanks are expressed in the conclusion to all those who worked on the
publication.
Translation into English: Stephanie Staffen
208
Eva Krâlikovâ
En attendant le bon moment...
Le sort du patrimoine de Milan
Rastislav Stefânik
Résumé
Cette publication est une première tentative pour donner un aperçu plus détaillé du sort
et de la situation actuelle du patrimoine de Milan Rastislav Stefânik après son transfert
à la première République Tchécoslovaque. Après la mort tragique de son propriétaire
son patrimoine resta à Paris rue Leclerc no. 6, dans l’appartement sous scellé qu’habitait
Stefânik (les biens mobiliers de lappartement). Les premiers à le visiter furent ses frères
Ladislav et Igor (1919), suivis par sa sœur Elena et par son frère Kazimir (1920) qui
dressèrent les premières listes incomplètes. Le sort de ses biens à leur arrivée dans la
république et par la suite fut aussi mouvementé que le destin de leur propriétaire. Après
leur arrivée à Prague en 1920 ces biens furent entreposés provisoirement au Mémorial de
la Résistance avant de faire partie en 1928 de l’exposition du Mémorial de la Libération
à Prague. De difficiles négociations entre la famille de M. R. Stefânik et le gouvernement
débouchèrent sur une solution définitive selon laquelle son patrimoine devint propriété
de l’état ; non seulement l’aspect financier de son estimation dans son ensemble devint-
elle cruciale mais aussi la question de son utilisation à venir. A l’origine la famille insista
sur son retour vers la Slovaquie et sur la création d’un musée commémoratif. Plus tard
elle accepta son achat par l’état. A la fin la famille ne fut pas satisfaite du montant payé
après l’estimation, somme qui finit par être acceptée à hauteur de 1 million 250 mille
couronnes. Des disputes sur la somme finale reçue continuèrent pendant les décennies
suivantes, suscitant l’intérêt de la presse slovaque autonomiste en particulier. Les restes
de l’accident tragique survenu à M. R. Stefânik, (débris de l’avion, lambeaux de vêtements
des trois autres personnes à bord) connurent aussi un sort intéressant. Même après leur
stockage provisoire à Bratislava, leur sort fut peu enviable : en raison de la mauvaise
sécurité des lieux de l’édifice gouvernemental (vols), ils furent peu à peu intégrés au reste
de la collection du Mémorial de la Libération à Prague.
Après la création de l’Etat Slovaque Indépendant (1939) il y eut de nouveaux efforts
pour rapatrier les objets en Slovaquie, menés surtout par le Musée National Slovaque
à Martin, qui préparait à l’époque sa première exposition à l’échelle nationale dans un
bâtiment nouvellement construit (1929 - 1932). Ses efforts furent couronnés de succès
en 1940 lorsque le gouvernement slovaque s’intéressa à la question et les biens furent
transférés d’abord à Bratislava et ensuite au MNS de Martin en grande pompe. Là la
majeure partie de ce patrimoine trouva sa place dans une exposition digne de lui dédié
209
à M. R. Stefânik. Cette présentation rencontra un grand succès auprès du public. Elle
montrait pour la première fois l’intérieur de son appartement parisien à travers des
objets authentiques. A cause de la nouvelle donne politique des années 50 et 60 pendant
lesquelles le nom de M. R. Stefânik avait été rayé de l’histoire nationale, l’exposition
avait dû être désinstallée après presque dix ans et les objets, considérés comme tabou,
stockés pendant longtemps dans les réserves du musée. L’ensemble des biens fit l’objet de
choix politiques et non scientifiques en raison du sort malheureux de son propriétaire.
Sa valeur de témoignage fut passée sous silence pendant une longue période. A la fin des
années 50 et dans la première moitié des années 60 la collection fut malheureusement
déplacée de lieu en lieu, ce qui impacta de façon significative et négative son intégrité.
Des collections spécialisées du patrimoine de M. R. Stefânik furent réparties entre
plusieurs collections, brisant ainsi surtout leur continuité et leur valeur de témoignage
authentique. Les collections de livres, de documents écrits, des éléments de mobiliers,
des objets techniques et les collections de sciences naturelles furent éparpillés. Il fallut
attendre 1990 pour que la situation s’améliore, époque à laquelle le nom de M. R. Stefânik
réintégra de nouveau notre histoire ; des historiens, des politiques, des membres des
organismes où étaient stockées ses collections s’intéressèrent de nouveau à son sort
et à son profil. De nouvelles expositions furent inaugurées dans la maison natale de
M. R. Stefânik à Kosariskâ (MNS - Musée des Conseils Nationaux Slovaque à Myjava)
et plusieurs projets furent élaborés pour les vernissages d’expositions visant à donner
une représentation fidèle du destin de ce héros national. Leur fond commun fut une
documentation authentique : ses biens peu connus à l’époque stockés dans les collections
des musées et des archives. La richesse des documents écrits et photographiques, la
valeur de témoignage des objets personnels tridimensionnels purent ainsi donner une
idée fidèle de leur propriétaire. Le personnel du Musée National Slovaque de Martin
et de Bratislava en particulier fut confronté à une tâche difficile : remettre dans son
état d’origine presque un siècle plus tard le patrimoine en fonction des archives et des
documents conservés. La tâche fut compliquée en raison de la nature fragmentée et vague
des documents d’époque, à partir de l’inventaire originel de la collection à son arrivée
à Prague (1920 - 1921), puis après son transfert en Slovaquie, plus précisément après ses
déplacements du Musée National Slovaque vers d’autres collections dans les années 60.
La présente publication est donc le fruit de cette recherche, avec des informations sur
les origines du fonds et un résumé de ce que nous avons pu constater et identifier. Elle
renseigne aussi sur les lieux où se trouvent à présent les collections de M. R. Stefânik.
Pour la plupart elles se trouvent au Musée National Slovaque de Martin (objets exotiques,
souvenirs personnels, photographies), pour d’autres dans les collections du MNS Musée
de l’Histoire de Bratislava, du MNS Muséum d’Histoire Naturelle de Bratislava (où
furent transférées les collections relatives aux sciences naturelles), de la Bibliothèque
Nationale Slovaque de Martin (collections de livres), des Archives Nationales Slovaques
de Bratislava (archive personnelle comprenant une riche collection de photographies),
du Musée de la Slovaquie Orientale de Kosice (mobilier) et du Musée Technique de
Kosice (objets techniques). Une partie importante du fonds se trouve à présent dans
l’exposition commémorative sur M. R. Stefânik à Kosariskâ, qui fait partie du MNS -
Musée des Conseils Nationaux Slovaque à Myjava (2005, 2015). Un nombre important
210
d’objets personnels donnés en 1933 par la famille de M. R. Stefânik se trouve dans les
collections du Musée de Balnéologie de Piestany. Une collection unique d’œuvres d’art
de Paul Gauguin, qui faisait partie du fonds, ne fut jamais rendue à la Slovaquie ; elle est
restée la propriété de la Galerie Nationale de Prague. L’étendue des inventaires originels
(Prague, Martin) et les imprécisions documentaires par rapport à l’état réel rendaient
difficile leur identification. La difficulté fut accrue par le traitement inapproprié des
collections, résultat des interventions politisées de l’état qui touchaient non seulement
leur propriétaire mais les objets qu’il nous a laissés. Aujourd’hui, presque cent ans après
la mort de M. R. Stefânik on peut encore supposer que bien des objets individuels non
identifiés (notamment ceux provenant de l’accident tragique) se trouvent dans d’autres
collections, non seulement à l’intérieur de la Slovaquie, mais aussi à l’étranger et peut-
être même aux mains de particuliers.
Plusieurs chapitres sont consacrés à la structure de la collection. Ils sont classés selon
le type de matériel en objets bidimensionnels (écrits, documents photographiques,
livres) et tridimensionnels (objets provenant de l’appartement de M. R. Stefânik, objets
personnels, objets témoignant de ses passe-temps et de ses centres d’intérêts, objets
de sciences naturelles, ainsi que sa collection d’illusionniste et de numismate, aides
scientifiques, uniformes, souvenirs de sa mort tragique et une collection de dessins de
drapeaux conçus par lui-même) qui constituent les chapitres les plus longs. Chaque
chapitre comprend une annexe contenant le catalogue imprimé des collections des
musées qui les abritent actuellement, décrivant brièvement la collection en question,
son sort et son acquisition par M. R. Stefânik. Les catalogues résument la collection
du Musée National Slovaque de Martin (la majeure partie du fonds: objets personnels,
collection principalement constituée d’objets exotiques, de photographies), du MNS
Musée d’Histoire de Bratislava (collections données par la famille en préparation
de la première exposition commémorative à Kosariskâ), du MNS Musée de Sciences
Naturelles de Bratislava (collections d’histoire naturelle lui ayant été attribuées), du
Musée de la Slovaquie Orientale de Kosice et du Musée de Markusovce (mobilier leur
ayant été attribué, se trouvant aujourd’hui dans les expositions de Kosariskâ), du Musée
Technique de Kosice (objets techniques lui ayant été attribués). Les objets personnels
déposés au Musée Balnéologique de Piestany sont résumés. Les documents d’archives
(écrits, photographies) ayant été attribués aux Archives Nationales Slovaques de
Bratislava sont accessibles grâce à un inventaire bien rédigé, comme l’est la liste des
livres stockés à la Bibliothèque Nationale Slovaque de Martin.
Un chapitre de grande ampleur contient une annexe de photographies (objets exotiques
et objets personnels tirés des collections du MNS de Martin, images des expositions
de Kosariskâ et de Piestany), notes, bibliographie, sources d’archives utilisées par
la recherche, ainsi qu’une liste des institutions où l’on peut trouver les collections
provenant du fonds M. R. Stefânik. En raison de la complexité du travail nécessaire
à l’identification du fonds M. R. Stefânik se trouvant dans différentes collections et
puisqu’un grand nombre d’experts et de collègues a participé à cette tâche, l’ouvrage se
termine en remerciant tous ceux qui y ont collaboré.
Traduction en français: Stéphanie Staffen
211
Pod’akovanie
Práca na príprave prvého súpisu zbierok z pozostalosti M. R. Stefánika bola nárocná.
Vyzadovala si spoluprácu s vellcym poctom spolupracovníkov - odborníkov z jednotlivych
pracovísk najmä Slovenského národného múzea v Martine a ostatnÿch fondovych praco-
vísk, kde su v súcasnosti zbierky ulozené. V prvom rade by som vsak chcela podákovat’ ve-
deniu Slovenského národného múzea v Bratislave, ktoré iniciovalo prípravu takejto práce
Mgr. Branislavovi Panisovi, generálnemu riaditelbvi SNM, vdaka ktorému edícia Museion
dostáva súcasnú podobu, PhDr. Gabriele Poduselovej, námestnícke GR SNM pre odborné
cinnosti, ktorá bola nielen odbornou konzultantkou, ale aj jednou z iniciátoriek predlozenej
práce, kolegom z jednotlivych pracovísk SNM Mgr. Jánovi Kautmanovi, riaditelbvi Prírodo-
vedného múzea SNM, spolupracovníkom v Historickom múzeu SNM, najmä Miroslavovi
Holiencinovi, mojim spolupracovníckam a priatelkám v SNM-Múzeu SNR na Myjave, ktoré
mi pomáhali pri nárocnych prácach, spojenÿch nielen s realizáciou expozície M. R. Stefánika
v Kosariskách, pracovníckam Kniznice SNM v Bratislave, ktoré mi velmi ochotne poskytli
literatúru o M. R. Stefánikovi. Dolezitú vypovednú hodnotu pri príprave práce mal pre mña
archívny fond M. R. Stefánika, ulozenÿ v Archive SNM v Bratislave, ktorÿ mi velmi ochot-
ne sprístupnila PhDr. Elena Machajdíková. Podakovanie patrí kolegovi z Balneologického
múzea v Piest’anoch PhDr. Andrejovi Bolerázskemu, pracovníkovi Stredoslovenského múzea
v Banskej Bystrici PhDr. Mariánovi Bovanovi. Nemozem nespomenút’ ochotu pracovníkov
Vÿchodoslovenského múzea v Kosiciach, ktorí mi boli velmi nápomocní pri identifikácií ná-
bytkovych solitérov z pozostalosti M. R. Stefánika este v case prípravy memoriálnej expozície
v Kosariskách v r. 2005 (PhDr. Róbert Pollák, riaditef), pracovníkov Slovenského technického
múzea v Kosiciach (Ing. Stefan Labanic, CSc., riaditel). Ochotní a ústretoví boli pracovníci
Slovenského národného archívu v Bratislave, (PhDr. Radoslav Ragac, PhD., Mgr. Erika Ja-
vosová, PhD.), Slovenskej národnej kniznice v Martine (PhDr. Peter Sabov, ktorÿ spracoval
súpis Stefánikovej kniznej pozostalosti). Osobitné podakovanie patrí Mgr. Michalovi Ksiña-
novi, PhD. z Historického ústavu SAV v Bratislave, ktorÿ velmi ochotne venoval svoju prácu
o M. R. Stefánikovi do Kniznice SNM v Martine.
Moja velká vdaka vsak patrí PhDr. Dusanovi Kovácovi, DrSc. pracovníkovi Historického
ústavu SAV v Bratislave za spoluprácu a najmä neocenitelné rady pri príprave expozicného
projektu v Kosariskách, vsetkych vystavnych projektov, ako aj kniznej publikácie o M. R. Ste-
fánikovi. Cenné rady mi poskytol aj ako recenzent predlozenej práce. Mali a majú pre mña
neocenitelnú hodnotu, jeho publikované práce venované M. R. Stefánikovi boli pre mña tou
základnou informáciou. Dakujem PhDr. Petrovi Marákymu, ktorÿ ako prvÿ inicioval prípra-
vu expozície M. R. Stefánika v r. 2005, neskor úspesnej vÿstavy a kniznej publikácie, mapujú-
cej neznámu fotografickú pozostalosf M. R. Stefánika.
Vÿznamné miesto pri práci so zbierkami v Slovenskom národnom múzeu v Martine za-
stávali kolegovia z tohto pracoviska. Predovsetkÿm PhDr. Márii Halmovej (riaditelka múzea)
dakujem za jej velkú ochotu a pomoc pri jazykovej a textovej úprave, mladÿm kolegom, ktorí
212
pokracujú v práci so zbierkami Mgr. Barbore Pekárikovej, Mgr. Marekovi Bothovi a Ma-
riánovi Veselovskému, ktorí mi boli nápomocní pri práci so zbierkami v depozite múzea,
Mgr. Michale Sedláckovej z Archívu SNM v Martine, PhDr. Anne Petovej, vedúcej Kniznice
SNM v Martine, pañi Alene Brozovej, dokumentaristke zbierkového fondu M. R. Stefáni-
ka. Dakujem za trpezlivosf a ochotu pri vyhotovovaní skenov Mgr. Eve Blahovej, dokumen-
taristke rozsiahleho fotografického archívu SNM. V tejto práci mi bola velmi nápomocná
Mgr. Milena Kiripolská, ktorá napriek castÿm casovym stresom mi dokázala vyhotovif
potrebné skeny. Za dokonalú fotografickú prílohu práce dakujem bÿvalému kolegovi, fotogra-
fovi Michalovi Pisnému, ktorÿ k danej úlohe pristúpil s absolútnou profesionalitou. Aj jeho
zásluhou dostali zbierky skutocny nádych exotiky krajín, ktoré Stefánik precestoval. Za foto-
grafickú prílohu a skeny dakujem aj kolegom z Balneologického múzea v Piesfanoch a Sloven-
ského národného archívu z Bratislavy.
Nemozem nespomenúf tych, ktorí sa pricinili o to, aby sa zbierka M. R. Stefánika stala
súcast’ou zbierkového fondu SNM v Martine. Jána Geryka, prvého správcu a riaditela SNM,
prvú archivárku SNM v Martine Dr. Máriu Jersovú-Opocenskú, spoluautorku prvej expo-
zície z r. 1941, ktorej zásluhou bola delimitácia archívneho fondu vykonaná na základe do-
konalych súpisov, kustódov SNM prof. Jána Hycku, kolegu PhDr. Vladimíra Zuberca, CSc,
bÿvalého pracovníka Historického múzea SNM, ktorí mi dali moznosf nahliadnuf do zbierok
M. R. Stefánika ocami skutocnÿch odborníkov. Moje osobné podákovanie, kedze uz nie sú
medzi nami, je mozné uz iba takouto formou. Uznanie patrí bÿvalému kolegovi PhDr. Moj-
mírovi Benzovi, PhD., ktorÿ polozil základ odborne spracovanej zbierky cudzokrajnej etno-
grafie v SNM v Martine, kolegom z Národného múzea-Náprstkovho múzea v Prahe, vd’aka
ktoryrn patria k odborne ídentifikovanym, co mi prácu velmi uláhcilo.
Za trpezlivosf s prácou na grafickej úprave predlozenej práce patrí moje podákovanie
Mgr. art. Matúsovi Lányimu. Svoj podiel na jej vypovednej hodnote vo vzt’ahu k zahranicnym
citatelom má pañi Stephanie Staffen, autorka francúzskeho a anglického prekladu resumé.
Aj ked v závere, ale o to srdecnejsie je podákovanie pañi Tamare Dudásovej, jednej z po-
slednÿch zijúcich priamych potomkov Milana Rastislava Stefánika. Aj zásluhou jej otea Pavía,
syna Ladislava, brata M. R. Stefánika, sa mnohé pamiatky z pozostalosti dostali do zbierok
SNM-Historického múzea este v case prípravy prvej expozície v Kosariskách (1969), vdaka
nej som mala moznosf nahliadnuf do viacerÿch rodinnÿch archívnych dokumentov, ktoré sú
vypovedné najmä vo vzfahu k osudom pozostalosti M. R. Stefánika. Ako jedna z mála vlastní
a opatruje este niekolko cennÿch relikvií na svojho vyznamného príbuzného, ktoré nedokáza-
la zaprief ani v case, ked jeho meno bolo pre ñu a jej rodinu skor na prífaz.
213
Literatúra
BARES, Arnost. Stefániküv memoriál. Praha : Památnik odboje, 1929. 147 s.
BARTÚSEK, Josef (red.). Kniha druhá: Vzpomínky, dokumenty ajiné pfíspevky.
Bratislava : Sväz slovenského studentstva v Bratislave a v Prahe, 1935.405 s.
VALENTOVlC, Stefan a kol. Slovensky biograficky slovník L A - D. Martin : Matica
slovenská, 1986. 583 s.
MAÍOVCÍK, Augustin a kol. Slovensky biograficky slovník IV M - Q. Martin : Matica
slovenská, 1990. 562 s. ISBN 80-7090-070-9.
MATOVCÍK, Augustin a kol. Slovensky biograficky slovník V. R-S. Martin : Matica
slovenská, 1992. 560 s. ISBN 80-7090-216-7.
BOLERÁZSKY, Andrej. Gen. Milan Rastislav Stefánik a stefánikovská tradícia
v Balneologickom múzeu Piestánoch. Piesfany : Balneologické múzeum Piesfany
a Trnavskÿ samosprávny kraj, 2009. 16 s.
BOLERÁZSKY, Andrej. Zivotná láska Ivana Krasku. In: Pamiatky a múzeá, 2004,
c. 4, s. 31 - 34.
BOTÍK, Ján. Slováci v Argentinskom Chacu. Bratislava : SNM, 2002. 304 s.
ISBN 80-7114-403-7.
CRUZ, Francisco J. - POLÍVKA, Vladimir. Dr. M. R. Stefánik v mojich spomienkach.
Praha : Melantrich, 1937. 72 s., obr.
FERENCUHOVÁ, Bohumila. M. R. Stefánik a cesko-slovenské hnutie v zahranici
v zrkadle francùzskych diplomatickÿch dokumentov. In: M. R. Stefánik V zrkadle
prameñov a najnovsich poznatkov Historiografie. Bratislava : Vojenskÿ historickÿ
ùstav - Ministerstvo obrany SR, 2010, s. 129 - 150. ISBN 978-80-970434-0-7.
GASPARÍKOVÁ - HORÁKOVÁ, Anna. UMasarykovcov : Spomienky osobnej
archivárky T. G. Masaryka. Bratislava : AEP, 1995. 304 s. ISBN: 80-967366-4-7.
HOLOTÍK, Ludovít. Stefánikovská legenda a vznik CSR. 2. vyd. Bratislava :
Vydavatelstvo Slovenskej akadémie vied, 1960. 535 s.
JENERÁLOVÁ, Mária. Osobnà kniznica Milana Rastislava Stefánika. In: Teória
a vyskum knihovníctva a bibliografie. Historické knizné fondy na Slovensku.
Vÿskumy 44. Martin : Matica slovenská, 1991, s. 164 - 170.
JURÍCEK, Ján. Milan Rastislav Stefánik vedec, politik, diplomat, letec, generâl,
minister clovek. Bratislava : Qlll, 2006. 167 s. ISBN : 80-89092-29-2.
KAUTSKŸ, Emil Karol. Kauza Stefániky Legendy, fakty a otázniky okolo vzniku Cesko-
slovenskej republiky. Martin : Matica slovenská, 2004. 295 s. ISBN 80-7090-759-2.
K ELE, Frantisek - MUSIL, Miroslav. Po Stefánikovych stopách : Návraty do Polynézie.
2. vydanie. Bratislava : EKO-KONZULT, 2009. 140 s. ISBN 978-80-8079-113-1.
KOLCÁKOVÁ, Karina. Ozdobnÿ záves z pozostalosti M. R. Stefánika. Restaurátorská
dokumentácia. In: Zborník SNM - Historia, roc. CI, 2010, c. 47, s. 37 - 50. ISBN
978-80-8060-268-0.
214
KOVÁC, Dusan. Milan Rastislav Stefánik : Portréty Budmerice : Rak, 1996. 77 str.
ISBN 80-85501-10-4.
KOVÁC, Dusan. Stefánik a fanin : Príbeh priateistva. Bratislava : Dilema, 2001. 163 s.
ISBN 80-968413-8-6.
KOVÁC, Dusan - KRÁLIKOVÁ, Eva - PAUER, Marián. Obrazopis sveta. Objektívom
Milana Rastislava Stefánika. Martin : Osveta, 2004. 135 s. ISBN 80-8063-166-2.
KRUPA, Vladimir. Pozostalosf Milana Rastislava Stefánika v zbierkovom fonde
Balneologického múzea v Piestanoch. In: Balneologicky sprievodca, 1992.
Piest’any : Balneologické múzeum, s. 139 - 154.
K§IÑAN, Michal. Milan Rastislav Stefánik. 1. vydanie. Brno : Computer Press, 2012.
63 s. ISBN 978-80-264-0114-8.
KSIÑAN, Michal. M. R. Stefánik ajeho vztáh k Francúzsku. Diplomová práca.
Pedagogická fakulta UK, Katedra historie, 2006, s. 69.
LIPTÁK, Lubomír. Storocie dlhsie ako sto rokov : O dejinách a historiografii.
Bratislava : Kalligram, 1999. 391 s. ISBN 80-7149-262-0.
MACHAJDÍKOVÁ, Elena. Sprievodca po Archive Slovenského národného múzea.
Bratislava : SNM, 2008. 190 s. ISBN 978-80-8060-237-6.
MELICHERCÍK, Ivan. Dobrodruzstvo zvané zberatelstvo. In: Kniznica, roe. 4,
c. 11-12. Martin : Slovenská národná kniznica, 2003, s. 600 - 604.
MINAROVICOVÁ, Elena. Numizmatická zbierka z pozostalosti M. R. Stefánika.
In: Zborník SNM - Historia, roc. LXV, 1971, c. 11, s. 153 - 154.
MÜLLER, Jirí. Pfehled etnologickÿch sbírek Náprstkovho musea Vseobecného
národopisu v Praze. In: Casopis Národního muzea. Praha, 1940, roc. 114,
c. 1, s. 118- 124.
ONDREJKOVÁ, Katarina. Draci odev z pozostalosti M. R. Stefánika. Restaurátorská
dokumentácia. In: Zborník SNM - Historia, roc. CI, 2010,
c. 47, s. 51 - 56. ISBN 978-80-8060-268-0.
OSUSKŸ, Stefan - PAVLÛ, Bohdan (red.). Stefánik, Kniha prvá : Spomienky
a postrehy. Praha - Bratislava : L. Mazác, 1938. 303 s.
PODUSEL, Lubomír. Paul Gauguin : Drevorezy a drevoryty : Maliarov„novy mytus(
vgrafickej tvorbe. Martin : Matica slovenská, 2008. 71 s.
ISBN 978-80-89208-80-7.
POLÍVKA, Vladimir. Korespondencia M. JR. Stefánika. Banská Bystrica : vlastnÿm
nákladom, 1928.
POLÍVKA, Vladimir, (úvod, pozn.): Korespondencia M. R. Stefánika. 2. vydanie.
Kosariská : Vydavatelstvo RECO pre Spolok rodákov M. R. Stefánika, 2003. 86 s.
ISBN 80-967551-5-3.
SABOV, Peter. Osudy osobnej kniznice generála M. R. Stefánika. In: M. R. Stefánik:
V zrkadle prameñov a najnovsich poznatkov Historiografie. Bratislava : Vojenskÿ
historickÿ ústav - Ministerstvo obrany SR, 2010, s. 263 - 267. ISBN 978-80-
970434-0-7.
215
SABOV, Peter. Osobnâ kniznica Milana Rastislava Stefânika, Historické kniznice
Slovenskej nârodnej kniznice v Martine, Kniznica Milana Rastislava Stefânika.
In: Peter Sabov a kol.: Sprievodcapo historickych knizniciach na Slovensku. II. zv.
Martin : Slovenskâ nârodnâ kniznica Martin, 2004. 110 s. ISBN 80-89023-34-7.
SROBÄR, Vavro. Z môjho zivota. Praha : Fr. Borovÿ, 1946. 545 s.
STEFÄNIK, Milan Rastislav. Z cesty po severnej Afrike. In: Tranovsky evanjelicky
kalendâr na r. 1910. Liptovskÿ Mikulâs, s. 129 - 137.
TOMCIK, Peter. Osudy predmetov z japonskej zbierky Milana Rastislava Stefânika.
In: Zbornik SNM - Histôria, roc. Cl, 2010, c. 47, s. 27 - 36. ISBN 978-80-8060-268-
0.
VARGA, Juraj. Niekol’ko poznâmok k Stefanikovej prirodovednej zberatelskej
cinnosti. In: Muzeum, roc. XIV, 1969, c. 3, s. 135.
ZAJONC, Juraj. Dve cinske textilie z pozostalosti Milana Rastislava Stefânika,
zo zbierky Slovenského nârodného müzea-Historického müzea v Bratislave,
In: Zbornik SNM - Histôria, roc. CI, 2010, c. 47, s. 5 - 26.
ISBN 978-80-8060-268-0.
ZUBEREC, Vladimir. Pozostalosf Milana Rastislava Stefânika. In: Muzeum,
roc. XIII, c. 3, 1968, s. 190-197.
ZUBEREC, Vladimir. Muzeum Milana Rastislava Stefânika. Katalog k expozidi,
Kosariskä. Bratislava : SNM-Historické müzeum, 1990, necislované.
ZUBEREC ,Vladimir. Milan Rastislav Stefänik - vedec, zberatel, politik. Katalog
vÿstavy. Bratislava : Ministerstvo kultüry SR, 1991.
ZUBEREC, Vladimir. Milan Rastislav Stefänik : Léta hvëzdnâ a vâlecnâ. Praha :
Melantrich, 1990. 40 s.
ZUBEREC, Vladimir. Zâluby a zâujmy Milana Rastislava Stefânika. In: Zbornik SNM
- Histôria, roc. LXXXVI, 1992, c. 32, s. 109 - 135. ISBN 80-217-0414-4.
216
|
| any_adam_object | 1 |
| author | Králiková, Eva ca. 20./21. Jh |
| author_GND | (DE-588)1136925856 |
| author_facet | Králiková, Eva ca. 20./21. Jh |
| author_role | aut |
| author_sort | Králiková, Eva ca. 20./21. Jh |
| author_variant | e k ek |
| building | Verbundindex |
| bvnumber | BV044414774 |
| ctrlnum | (OCoLC)1002250609 (DE-599)BVBBV044414774 |
| edition | 1. vydanie |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>02591nam a2200481 cb4500</leader><controlfield tag="001">BV044414774</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20180927 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">170718s2017 c||| |||| 00||| slo d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9788080603953</subfield><subfield code="9">978-80-8060-395-3</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1002250609</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV044414774</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">slo</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">OST</subfield><subfield code="q">DE-12</subfield><subfield code="2">fid</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Králiková, Eva</subfield><subfield code="d">ca. 20./21. Jh.</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1136925856</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Len čas musel dozrieť ...</subfield><subfield code="b">osudy pozostalosti Milana Rastislava Štefánika = Waiting for the right time ... : the fate of Milan Rastislav Štefánik's estate = En attendant le bon moment ... : le sort du patrimoine de Milan Rastislav Štefánik</subfield><subfield code="c">Eva Králiková</subfield></datafield><datafield tag="246" ind1="1" ind2="1"><subfield code="a">Waiting for the right time ...</subfield></datafield><datafield tag="246" ind1="1" ind2="1"><subfield code="a">En attendant le bon moment ...</subfield></datafield><datafield tag="250" ind1=" " ind2=" "><subfield code="a">1. vydanie</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Bratislava</subfield><subfield code="b">Slovenské národné múzeum</subfield><subfield code="c">2017</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">219 Seiten</subfield><subfield code="b">Faksimiles, Porträts</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">sti</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Museion</subfield><subfield code="v">2. zväzok</subfield></datafield><datafield tag="546" ind1=" " ind2=" "><subfield code="a">Zusammenfassungen in englischer und französischer Sprache</subfield></datafield><datafield tag="600" ind1="1" ind2="7"><subfield code="a">Štefánik, Milan Rastislav</subfield><subfield code="d">1880-1919</subfield><subfield code="0">(DE-588)119070847</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Štefánik, Milan Rastislav</subfield><subfield code="d">1880-1919</subfield><subfield code="0">(DE-588)119070847</subfield><subfield code="D">p</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="710" ind1="2" ind2=" "><subfield code="a">Slovenské národné múzeum</subfield><subfield code="0">(DE-588)1008388-1</subfield><subfield code="4">isb</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Museion</subfield><subfield code="v">2. zväzok</subfield><subfield code="w">(DE-604)BV044365678</subfield><subfield code="9">2</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029816494&sequence=000004&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029816494&sequence=000005&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Abstract</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029816494&sequence=000006&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Literaturverzeichnis</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">oe</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-029816494</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">909</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09041</subfield><subfield code="g">437</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">929</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09041</subfield><subfield code="g">4373</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">929</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09034</subfield><subfield code="g">4373</subfield></datafield></record></collection> |
| id | DE-604.BV044414774 |
| illustrated | Illustrated |
| indexdate | 2024-07-10T07:52:20Z |
| institution | BVB |
| institution_GND | (DE-588)1008388-1 |
| isbn | 9788080603953 |
| language | Slovak |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-029816494 |
| oclc_num | 1002250609 |
| open_access_boolean | |
| owner | DE-12 |
| owner_facet | DE-12 |
| physical | 219 Seiten Faksimiles, Porträts |
| publishDate | 2017 |
| publishDateSearch | 2017 |
| publishDateSort | 2017 |
| publisher | Slovenské národné múzeum |
| record_format | marc |
| series | Museion |
| series2 | Museion |
| spelling | Králiková, Eva ca. 20./21. Jh. Verfasser (DE-588)1136925856 aut Len čas musel dozrieť ... osudy pozostalosti Milana Rastislava Štefánika = Waiting for the right time ... : the fate of Milan Rastislav Štefánik's estate = En attendant le bon moment ... : le sort du patrimoine de Milan Rastislav Štefánik Eva Králiková Waiting for the right time ... En attendant le bon moment ... 1. vydanie Bratislava Slovenské národné múzeum 2017 219 Seiten Faksimiles, Porträts txt rdacontent sti rdacontent n rdamedia nc rdacarrier Museion 2. zväzok Zusammenfassungen in englischer und französischer Sprache Štefánik, Milan Rastislav 1880-1919 (DE-588)119070847 gnd rswk-swf Štefánik, Milan Rastislav 1880-1919 (DE-588)119070847 p DE-604 Slovenské národné múzeum (DE-588)1008388-1 isb Museion 2. zväzok (DE-604)BV044365678 2 Digitalisierung BSB München 19 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029816494&sequence=000004&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis Digitalisierung BSB München 19 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029816494&sequence=000005&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA Abstract Digitalisierung BSB München 19 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029816494&sequence=000006&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA Literaturverzeichnis |
| spellingShingle | Králiková, Eva ca. 20./21. Jh Len čas musel dozrieť ... osudy pozostalosti Milana Rastislava Štefánika = Waiting for the right time ... : the fate of Milan Rastislav Štefánik's estate = En attendant le bon moment ... : le sort du patrimoine de Milan Rastislav Štefánik Museion Štefánik, Milan Rastislav 1880-1919 (DE-588)119070847 gnd |
| subject_GND | (DE-588)119070847 |
| title | Len čas musel dozrieť ... osudy pozostalosti Milana Rastislava Štefánika = Waiting for the right time ... : the fate of Milan Rastislav Štefánik's estate = En attendant le bon moment ... : le sort du patrimoine de Milan Rastislav Štefánik |
| title_alt | Waiting for the right time ... En attendant le bon moment ... |
| title_auth | Len čas musel dozrieť ... osudy pozostalosti Milana Rastislava Štefánika = Waiting for the right time ... : the fate of Milan Rastislav Štefánik's estate = En attendant le bon moment ... : le sort du patrimoine de Milan Rastislav Štefánik |
| title_exact_search | Len čas musel dozrieť ... osudy pozostalosti Milana Rastislava Štefánika = Waiting for the right time ... : the fate of Milan Rastislav Štefánik's estate = En attendant le bon moment ... : le sort du patrimoine de Milan Rastislav Štefánik |
| title_full | Len čas musel dozrieť ... osudy pozostalosti Milana Rastislava Štefánika = Waiting for the right time ... : the fate of Milan Rastislav Štefánik's estate = En attendant le bon moment ... : le sort du patrimoine de Milan Rastislav Štefánik Eva Králiková |
| title_fullStr | Len čas musel dozrieť ... osudy pozostalosti Milana Rastislava Štefánika = Waiting for the right time ... : the fate of Milan Rastislav Štefánik's estate = En attendant le bon moment ... : le sort du patrimoine de Milan Rastislav Štefánik Eva Králiková |
| title_full_unstemmed | Len čas musel dozrieť ... osudy pozostalosti Milana Rastislava Štefánika = Waiting for the right time ... : the fate of Milan Rastislav Štefánik's estate = En attendant le bon moment ... : le sort du patrimoine de Milan Rastislav Štefánik Eva Králiková |
| title_short | Len čas musel dozrieť ... |
| title_sort | len cas musel dozriet osudy pozostalosti milana rastislava stefanika waiting for the right time the fate of milan rastislav stefanik s estate en attendant le bon moment le sort du patrimoine de milan rastislav stefanik |
| title_sub | osudy pozostalosti Milana Rastislava Štefánika = Waiting for the right time ... : the fate of Milan Rastislav Štefánik's estate = En attendant le bon moment ... : le sort du patrimoine de Milan Rastislav Štefánik |
| topic | Štefánik, Milan Rastislav 1880-1919 (DE-588)119070847 gnd |
| topic_facet | Štefánik, Milan Rastislav 1880-1919 |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029816494&sequence=000004&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029816494&sequence=000005&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029816494&sequence=000006&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA |
| volume_link | (DE-604)BV044365678 |
| work_keys_str_mv | AT kralikovaeva lencasmuseldozrietosudypozostalostimilanarastislavastefanikawaitingfortherighttimethefateofmilanrastislavstefaniksestateenattendantlebonmomentlesortdupatrimoinedemilanrastislavstefanik AT slovenskenarodnemuzeum lencasmuseldozrietosudypozostalostimilanarastislavastefanikawaitingfortherighttimethefateofmilanrastislavstefaniksestateenattendantlebonmomentlesortdupatrimoinedemilanrastislavstefanik AT kralikovaeva waitingfortherighttime AT slovenskenarodnemuzeum waitingfortherighttime AT kralikovaeva enattendantlebonmoment AT slovenskenarodnemuzeum enattendantlebonmoment |