Contemporary examinations of classical languages (Hebrew, Aramaic, Syriac, and Greek): valency, lexicography, grammar, and manuscripts
Gespeichert in:
| Weitere Verfasser: | , , |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
Piscataway, NJ
Gorgias Press
2016
|
| Schriftenreihe: | Perspectives on linguistics and ancient languages
8 |
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | Selection of papers presented at a variety of conferences: presented at the International Syriac Language Project meetings at two conferences: the XIth Symposium Syriacum in Malta, 16-18 July 2012 and the International Organization for the Study of the Old Testament in Munich, 4-9 August 2013, and one paper each came from the SBL International Meeting in Amsterdam, 22-26 July 2012, and the 217th Annual Meeting of the American Oriental Society at San Antonio, Texas, 15-19 March 2007. - Includes bibliographical references and index |
| Beschreibung: | xxii, 267 Seiten Illustrationen |
| ISBN: | 9781463206567 |
Internformat
MARC
| LEADER | 00000nam a2200000 cb4500 | ||
|---|---|---|---|
| 001 | BV044032637 | ||
| 003 | DE-604 | ||
| 005 | 20171018 | ||
| 007 | t | ||
| 008 | 170207s2016 xxua||| |||| 10||| eng d | ||
| 020 | |a 9781463206567 |c hardback |9 978-1-4632-0656-7 | ||
| 035 | |a (gbd)1091980 | ||
| 035 | |a (OCoLC)1002274743 | ||
| 035 | |a (DE-599)BVBBV044032637 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng | |
| 044 | |a xxu |c US | ||
| 049 | |a DE-20 |a DE-12 | ||
| 050 | 0 | |a PJ3001.5 | |
| 082 | 0 | |a 492 |2 23 | |
| 084 | |a ALT |q DE-12 |2 fid | ||
| 245 | 1 | 0 | |a Contemporary examinations of classical languages (Hebrew, Aramaic, Syriac, and Greek) |b valency, lexicography, grammar, and manuscripts |c edited by Timothy Martin Lewis, Alison G. Salvesen, Beryl Turner |
| 264 | 1 | |a Piscataway, NJ |b Gorgias Press |c 2016 | |
| 300 | |a xxii, 267 Seiten |b Illustrationen | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 1 | |a Perspectives on linguistics and ancient languages |v 8 | |
| 500 | |a Selection of papers presented at a variety of conferences: presented at the International Syriac Language Project meetings at two conferences: the XIth Symposium Syriacum in Malta, 16-18 July 2012 and the International Organization for the Study of the Old Testament in Munich, 4-9 August 2013, and one paper each came from the SBL International Meeting in Amsterdam, 22-26 July 2012, and the 217th Annual Meeting of the American Oriental Society at San Antonio, Texas, 15-19 March 2007. - Includes bibliographical references and index | ||
| 650 | 4 | |a Semitic languages |v Congresses | |
| 650 | 4 | |a Greek language |v Congresses | |
| 650 | 0 | 7 | |a Semitische Sprachen |0 (DE-588)4116476-3 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Linguistik |0 (DE-588)4074250-7 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Griechisch |0 (DE-588)4113791-7 |2 gnd |9 rswk-swf |
| 655 | 7 | |0 (DE-588)4143413-4 |a Aufsatzsammlung |2 gnd-content | |
| 655 | 7 | |0 (DE-588)1071861417 |a Konferenzschrift |2 gnd-content | |
| 689 | 0 | 0 | |a Semitische Sprachen |0 (DE-588)4116476-3 |D s |
| 689 | 0 | 1 | |a Griechisch |0 (DE-588)4113791-7 |D s |
| 689 | 0 | 2 | |a Linguistik |0 (DE-588)4074250-7 |D s |
| 689 | 0 | |5 DE-604 | |
| 700 | 1 | |a Lewis, Timothy Martin |0 (DE-588)1137584181 |4 edt | |
| 700 | 1 | |a Salvesen, Alison |d ca. 20./21. Jh. |0 (DE-588)1101468319 |4 edt | |
| 700 | 1 | |a Turner, Beryl |4 edt | |
| 830 | 0 | |a Perspectives on linguistics and ancient languages |v 8 |w (DE-604)BV041062532 |9 8 | |
| 856 | 4 | 2 | |m Digitalisierung BSB Muenchen - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029439870&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 940 | 1 | |n oe | |
| 940 | 1 | |n gbd | |
| 940 | 1 | |q gbd_4_1709 | |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-029439870 | ||
| 942 | 1 | 1 | |c 480 |e 22/bsb |g 38 |
| 942 | 1 | 1 | |c 417.7 |e 22/bsb |f 0901 |g 394 |
Datensatz im Suchindex
| _version_ | 1804177036963479552 |
|---|---|
| adam_text | Table of Contents
Table of Contents.................................................v
Series Preface................................................ vii
The Complexity of Simplicity.....................................ix
Editors and Contributors to this Volume..........................xi
Introduction...................................................xiii
Acknowledgements................................................xix
Abbreviations...................................................xxi
Examining Verbs: Putting Syntax into Lexica and Grammars
Chapter 1 Who commits adultery with whom, and why it matters
in a lexicon............................................. 1
Beryl Turner
Chapter 2 Soundings with regard to Verbal Valency in the Peshitta Old
Testament............................................... 19
Jerome A. Lund
Chapter 3 How do Hebrew Verbs Differ? A Flow Chart of the Differences.. 33
Janet W. Dyk
Chapter 4 Valency: The Intersection of Syntax and Semantics......53
John A. Cook
Chapter 5 How to Classify Hebrew Verbs: Plotting Verb-Specific Roles.67
Nicolai Winther-Nielsen
Chapter 6 The Proper Role of Valency in Biblical Hebrew Studies..95
A. Dean Forbes
Examining Particles: Lexical Correspondences and Lexical
Developments
Chapter 7 The use of Syriac in rendering Hebrew Π3Π and Greek ιδού
or ϊδε in the Peshitta to Genesis and the Gospels.............113
Mats Eskhult
Chapter 8 The Function and Etymology of the Aramaic Particle l^m՝.
A Re-Examination....................................... 121
Na’ama Pat-El
V
vi Contemporary Examinations of Classical Languages
Examining Manuscripts and Text-Critical Matters
Chapter 9 Exploring Patterns of Accentuation in BL Add. MS 12138
(the East-Syrian “Masora”): Perspectives and Possibilities....139
Jonathan Loopstra
Chapter 10 Embedded Oracles: Sortilege in a Syriac Gospel Codex...167
Jeff Childers
Chapter 11 The Lexicon of the Tabernacle Accounts in the Syrohexapla
Version of Exodus.............................................187
Alison G. Salvesen
Chapter 12 Towards a New Critical Edition and Translation of Ishocdad of
Merw’s Commentary on the Gospel of John with an Identification of his
Sources.......................................................201
JOHAN D. HOFSTRA
Chapter 13 The Hebrew as a Text Critical Tool in Restoring Genuine
Peshitta Readings in Isaiah...................................239
Jerome A. Lund
Index.............................................................251
|
| any_adam_object | 1 |
| author2 | Lewis, Timothy Martin Salvesen, Alison ca. 20./21. Jh Turner, Beryl |
| author2_role | edt edt edt |
| author2_variant | t m l tm tml a s as b t bt |
| author_GND | (DE-588)1137584181 (DE-588)1101468319 |
| author_facet | Lewis, Timothy Martin Salvesen, Alison ca. 20./21. Jh Turner, Beryl |
| building | Verbundindex |
| bvnumber | BV044032637 |
| callnumber-first | P - Language and Literature |
| callnumber-label | PJ3001 |
| callnumber-raw | PJ3001.5 |
| callnumber-search | PJ3001.5 |
| callnumber-sort | PJ 43001.5 |
| callnumber-subject | PJ - Oriental |
| ctrlnum | (gbd)1091980 (OCoLC)1002274743 (DE-599)BVBBV044032637 |
| dewey-full | 492 |
| dewey-hundreds | 400 - Language |
| dewey-ones | 492 - Afro-Asiatic languages |
| dewey-raw | 492 |
| dewey-search | 492 |
| dewey-sort | 3492 |
| dewey-tens | 490 - Other languages |
| discipline | Außereuropäische Sprachen und Literaturen |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>02874nam a2200577 cb4500</leader><controlfield tag="001">BV044032637</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20171018 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">170207s2016 xxua||| |||| 10||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781463206567</subfield><subfield code="c">hardback</subfield><subfield code="9">978-1-4632-0656-7</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(gbd)1091980</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1002274743</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV044032637</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">xxu</subfield><subfield code="c">US</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-20</subfield><subfield code="a">DE-12</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">PJ3001.5</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">492</subfield><subfield code="2">23</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">ALT</subfield><subfield code="q">DE-12</subfield><subfield code="2">fid</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Contemporary examinations of classical languages (Hebrew, Aramaic, Syriac, and Greek)</subfield><subfield code="b">valency, lexicography, grammar, and manuscripts</subfield><subfield code="c">edited by Timothy Martin Lewis, Alison G. Salvesen, Beryl Turner</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Piscataway, NJ</subfield><subfield code="b">Gorgias Press</subfield><subfield code="c">2016</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">xxii, 267 Seiten</subfield><subfield code="b">Illustrationen</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Perspectives on linguistics and ancient languages</subfield><subfield code="v">8</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Selection of papers presented at a variety of conferences: presented at the International Syriac Language Project meetings at two conferences: the XIth Symposium Syriacum in Malta, 16-18 July 2012 and the International Organization for the Study of the Old Testament in Munich, 4-9 August 2013, and one paper each came from the SBL International Meeting in Amsterdam, 22-26 July 2012, and the 217th Annual Meeting of the American Oriental Society at San Antonio, Texas, 15-19 March 2007. - Includes bibliographical references and index</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Semitic languages</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Greek language</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Semitische Sprachen</subfield><subfield code="0">(DE-588)4116476-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Linguistik</subfield><subfield code="0">(DE-588)4074250-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Griechisch</subfield><subfield code="0">(DE-588)4113791-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)4143413-4</subfield><subfield code="a">Aufsatzsammlung</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)1071861417</subfield><subfield code="a">Konferenzschrift</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Semitische Sprachen</subfield><subfield code="0">(DE-588)4116476-3</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Griechisch</subfield><subfield code="0">(DE-588)4113791-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Linguistik</subfield><subfield code="0">(DE-588)4074250-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Lewis, Timothy Martin</subfield><subfield code="0">(DE-588)1137584181</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Salvesen, Alison</subfield><subfield code="d">ca. 20./21. Jh.</subfield><subfield code="0">(DE-588)1101468319</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Turner, Beryl</subfield><subfield code="4">edt</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Perspectives on linguistics and ancient languages</subfield><subfield code="v">8</subfield><subfield code="w">(DE-604)BV041062532</subfield><subfield code="9">8</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB Muenchen - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029439870&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">oe</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">gbd</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">gbd_4_1709</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-029439870</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">480</subfield><subfield code="e">22/bsb</subfield><subfield code="g">38</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">417.7</subfield><subfield code="e">22/bsb</subfield><subfield code="f">0901</subfield><subfield code="g">394</subfield></datafield></record></collection> |
| genre | (DE-588)4143413-4 Aufsatzsammlung gnd-content (DE-588)1071861417 Konferenzschrift gnd-content |
| genre_facet | Aufsatzsammlung Konferenzschrift |
| id | DE-604.BV044032637 |
| illustrated | Illustrated |
| indexdate | 2024-07-10T07:41:42Z |
| institution | BVB |
| isbn | 9781463206567 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-029439870 |
| oclc_num | 1002274743 |
| open_access_boolean | |
| owner | DE-20 DE-12 |
| owner_facet | DE-20 DE-12 |
| physical | xxii, 267 Seiten Illustrationen |
| psigel | gbd_4_1709 |
| publishDate | 2016 |
| publishDateSearch | 2016 |
| publishDateSort | 2016 |
| publisher | Gorgias Press |
| record_format | marc |
| series | Perspectives on linguistics and ancient languages |
| series2 | Perspectives on linguistics and ancient languages |
| spelling | Contemporary examinations of classical languages (Hebrew, Aramaic, Syriac, and Greek) valency, lexicography, grammar, and manuscripts edited by Timothy Martin Lewis, Alison G. Salvesen, Beryl Turner Piscataway, NJ Gorgias Press 2016 xxii, 267 Seiten Illustrationen txt rdacontent n rdamedia nc rdacarrier Perspectives on linguistics and ancient languages 8 Selection of papers presented at a variety of conferences: presented at the International Syriac Language Project meetings at two conferences: the XIth Symposium Syriacum in Malta, 16-18 July 2012 and the International Organization for the Study of the Old Testament in Munich, 4-9 August 2013, and one paper each came from the SBL International Meeting in Amsterdam, 22-26 July 2012, and the 217th Annual Meeting of the American Oriental Society at San Antonio, Texas, 15-19 March 2007. - Includes bibliographical references and index Semitic languages Congresses Greek language Congresses Semitische Sprachen (DE-588)4116476-3 gnd rswk-swf Linguistik (DE-588)4074250-7 gnd rswk-swf Griechisch (DE-588)4113791-7 gnd rswk-swf (DE-588)4143413-4 Aufsatzsammlung gnd-content (DE-588)1071861417 Konferenzschrift gnd-content Semitische Sprachen (DE-588)4116476-3 s Griechisch (DE-588)4113791-7 s Linguistik (DE-588)4074250-7 s DE-604 Lewis, Timothy Martin (DE-588)1137584181 edt Salvesen, Alison ca. 20./21. Jh. (DE-588)1101468319 edt Turner, Beryl edt Perspectives on linguistics and ancient languages 8 (DE-604)BV041062532 8 Digitalisierung BSB Muenchen - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029439870&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Contemporary examinations of classical languages (Hebrew, Aramaic, Syriac, and Greek) valency, lexicography, grammar, and manuscripts Perspectives on linguistics and ancient languages Semitic languages Congresses Greek language Congresses Semitische Sprachen (DE-588)4116476-3 gnd Linguistik (DE-588)4074250-7 gnd Griechisch (DE-588)4113791-7 gnd |
| subject_GND | (DE-588)4116476-3 (DE-588)4074250-7 (DE-588)4113791-7 (DE-588)4143413-4 (DE-588)1071861417 |
| title | Contemporary examinations of classical languages (Hebrew, Aramaic, Syriac, and Greek) valency, lexicography, grammar, and manuscripts |
| title_auth | Contemporary examinations of classical languages (Hebrew, Aramaic, Syriac, and Greek) valency, lexicography, grammar, and manuscripts |
| title_exact_search | Contemporary examinations of classical languages (Hebrew, Aramaic, Syriac, and Greek) valency, lexicography, grammar, and manuscripts |
| title_full | Contemporary examinations of classical languages (Hebrew, Aramaic, Syriac, and Greek) valency, lexicography, grammar, and manuscripts edited by Timothy Martin Lewis, Alison G. Salvesen, Beryl Turner |
| title_fullStr | Contemporary examinations of classical languages (Hebrew, Aramaic, Syriac, and Greek) valency, lexicography, grammar, and manuscripts edited by Timothy Martin Lewis, Alison G. Salvesen, Beryl Turner |
| title_full_unstemmed | Contemporary examinations of classical languages (Hebrew, Aramaic, Syriac, and Greek) valency, lexicography, grammar, and manuscripts edited by Timothy Martin Lewis, Alison G. Salvesen, Beryl Turner |
| title_short | Contemporary examinations of classical languages (Hebrew, Aramaic, Syriac, and Greek) |
| title_sort | contemporary examinations of classical languages hebrew aramaic syriac and greek valency lexicography grammar and manuscripts |
| title_sub | valency, lexicography, grammar, and manuscripts |
| topic | Semitic languages Congresses Greek language Congresses Semitische Sprachen (DE-588)4116476-3 gnd Linguistik (DE-588)4074250-7 gnd Griechisch (DE-588)4113791-7 gnd |
| topic_facet | Semitic languages Congresses Greek language Congresses Semitische Sprachen Linguistik Griechisch Aufsatzsammlung Konferenzschrift |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029439870&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| volume_link | (DE-604)BV041062532 |
| work_keys_str_mv | AT lewistimothymartin contemporaryexaminationsofclassicallanguageshebrewaramaicsyriacandgreekvalencylexicographygrammarandmanuscripts AT salvesenalison contemporaryexaminationsofclassicallanguageshebrewaramaicsyriacandgreekvalencylexicographygrammarandmanuscripts AT turnerberyl contemporaryexaminationsofclassicallanguageshebrewaramaicsyriacandgreekvalencylexicographygrammarandmanuscripts |