Sakrificat e popullit shqiptar dhe smirasve për identitet kombëtar gjatë viteve 1868-1999:
Gespeichert in:
1. Verfasser: | |
---|---|
Format: | Buch |
Sprache: | Albanian |
Veröffentlicht: |
Prishtinë
Armagedoni
2016
|
Schlagworte: | |
Online-Zugang: | Inhaltsverzeichnis Literaturverzeichnis Abstract |
Beschreibung: | 228 Seiten Illustrationen, Portrtäts, Karten |
ISBN: | 9789951697095 |
Internformat
MARC
LEADER | 00000nam a2200000 c 4500 | ||
---|---|---|---|
001 | BV043982737 | ||
003 | DE-604 | ||
007 | t| | ||
008 | 161230s2016 xx ac|| |||| 00||| alb d | ||
020 | |a 9789951697095 |9 978-9951-697-09-5 | ||
035 | |a (OCoLC)968704371 | ||
035 | |a (DE-599)BVBBV043982737 | ||
040 | |a DE-604 |b ger |e rda | ||
041 | 0 | |a alb | |
049 | |a DE-12 | ||
084 | |a 7,41 |2 ssgn | ||
100 | 1 | |a Ahmeti, Feriz |d 1944- |e Verfasser |0 (DE-588)1122509057 |4 aut | |
245 | 1 | 0 | |a Sakrificat e popullit shqiptar dhe smirasve për identitet kombëtar gjatë viteve 1868-1999 |c Feriz Ahmeti |
264 | 1 | |a Prishtinë |b Armagedoni |c 2016 | |
300 | |a 228 Seiten |b Illustrationen, Portrtäts, Karten | ||
336 | |b txt |2 rdacontent | ||
337 | |b n |2 rdamedia | ||
338 | |b nc |2 rdacarrier | ||
546 | |a Zusammenfassung in englischer Sprache | ||
610 | 2 | 7 | |a Ushtria Çlirimtare e Kosovës |0 (DE-588)4549901-9 |2 gnd |9 rswk-swf |
648 | 7 | |a Geschichte 1868-1999 |2 gnd |9 rswk-swf | |
650 | 0 | 7 | |a Unabhängigkeitsbewegung |0 (DE-588)4121814-0 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Erster Weltkrieg |0 (DE-588)4079163-4 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Nationalbewusstsein |0 (DE-588)4041282-9 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Zweiter Weltkrieg |0 (DE-588)4079167-1 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Kosovo-Krieg |0 (DE-588)4547508-8 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Albaner |0 (DE-588)4068517-2 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Albanischer Aufstand |g 1910 |0 (DE-588)1028274998 |2 gnd |9 rswk-swf |
651 | 7 | |a Smirë |0 (DE-588)1122509014 |2 gnd |9 rswk-swf | |
651 | 7 | |a Kosovo |0 (DE-588)4032571-4 |2 gnd |9 rswk-swf | |
689 | 0 | 0 | |a Kosovo |0 (DE-588)4032571-4 |D g |
689 | 0 | 1 | |a Smirë |0 (DE-588)1122509014 |D g |
689 | 0 | 2 | |a Albaner |0 (DE-588)4068517-2 |D s |
689 | 0 | 3 | |a Unabhängigkeitsbewegung |0 (DE-588)4121814-0 |D s |
689 | 0 | 4 | |a Nationalbewusstsein |0 (DE-588)4041282-9 |D s |
689 | 0 | 5 | |a Geschichte 1868-1999 |A z |
689 | 0 | |5 DE-604 | |
689 | 1 | 0 | |a Smirë |0 (DE-588)1122509014 |D g |
689 | 1 | 1 | |a Albanischer Aufstand |g 1910 |0 (DE-588)1028274998 |D s |
689 | 1 | 2 | |a Erster Weltkrieg |0 (DE-588)4079163-4 |D s |
689 | 1 | 3 | |a Zweiter Weltkrieg |0 (DE-588)4079167-1 |D s |
689 | 1 | 4 | |a Kosovo-Krieg |0 (DE-588)4547508-8 |D s |
689 | 1 | 5 | |a Ushtria Çlirimtare e Kosovës |0 (DE-588)4549901-9 |D b |
689 | 1 | |5 DE-604 | |
856 | 4 | 2 | |m Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029391133&sequence=000004&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
856 | 4 | 2 | |m Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029391133&sequence=000005&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |3 Literaturverzeichnis |
856 | 4 | 2 | |m Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029391133&sequence=000006&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA |3 Abstract |
940 | 1 | |n oe | |
940 | 1 | |q BSBWK1 | |
942 | 1 | 1 | |c 909 |e 22/bsb |f 09034 |g 4975 |
942 | 1 | 1 | |c 307.09 |e 22/bsb |f 0904 |g 4975 |
942 | 1 | 1 | |c 307.09 |e 22/bsb |f 09034 |g 4975 |
942 | 1 | 1 | |c 909 |e 22/bsb |f 0904 |g 4975 |
942 | 1 | 1 | |c 355.009 |e 22/bsb |f 0904 |g 4975 |
942 | 1 | 1 | |c 355.009 |e 22/bsb |f 09034 |g 4975 |
943 | 1 | |a oai:aleph.bib-bvb.de:BVB01-029391133 |
Datensatz im Suchindex
_version_ | 1817507377612587008 |
---|---|
adam_text |
Sakrificat e popullit shqiptar dhe smirasve për identitet kombëtarprej vitit Î868-1999
LËNDË SH TRIRJA
KONTRIBUTI1 SMIRASVE NGA E KALUARA
E GJER MË SOT
PARATHËNJE .
1. Qëndresa, trimëria, heroizmi, lavdia e smirasve
dhe dhuna e terrori i pushtuesve mbi këtë pjesë
të popullit liridashës
1.1. Lashtësia dhe shtrirja territoriale e Smirës
1.2. Rithemelimi i venbanimit
1.3. Shtrirja territoriale e Smirës .
1.4. Lagjet e para të Smirës
2. Shënime statistikore .
2.1. Çka ishte Itifati?
3. Kontributi dhe sfidat e shqiptarëve dhe smirasve
për identitet kombëtar
3.1. Smirasit e rënë ne fushëbeteja, të masakruar
dhe të zhdukur nga pushtuesit e huaj, gjatë viteve
1868-1999 . .
3.2. Ndërgjegja shqiptare e kohës .
3.3. Kriza lindore e viteve të '70-ta dhe coptimet
e tokave shqiptare
3.4. Ndërgjegja kombëtare
4. Smirasit gjatë lëvizjeve kombëtare .
4.1. Lidhja e Parë e Prizrenit më 10.6. 1878
5. Shqiptarët gjatë marrëveshjes ruso-austrohungareze
të vitit 1897 . .
6. Smirasit gjatë lëvizjeve dhe kryengritjeve
shqiptare (1908-1912).
6.1. Tubimi i Ferizajt në korrik te vitit 1908
6.2. Pas tubimit të Ferzajt .
7. Smirasit gjatë kryengritjeve shqiptare të vitit 1910
7.1. Ushtarët osmanë të zënë robër më 1910 vendosen
në xhaminë e Smirës .
8. Vendimet e Itifatit me karakter ekzekutiv
8.1. Itifati e humb karakterin ekzekutiv dhe
shëndrrohet në Këshill
9. Ngjarjet e vitit 1912 . . .
. 1
. 3
. 4
. 9
.13
.17
.19
.20
.25
.25
.28
.29
.32
.35
.35
.40
.42
.44
.46
.47
.55
.58
.59
.60
225|
Feriz AHMETI
9.1. Deklarata dhe vend imet e Kuvendit të Junikut .62
9.2. Fronti i Kumanovës . .58
9.3. Fronti i Ferizajt .70
9.4. Masakra e Smirës me 1912 . .74
9.5. Pasojat e Masakrës së Smirës .77
10. Periudha e depërtimit sërb në Kosovë (1912-1915) .78
10.1. Gjenocidi i Sërbisë në Kosovë gjatë viteve 1912-1999 .79
10.2. Gjenocidi sërb në Smirë dhe dhuna për shpërngulje .81
11. Kosova gjatë viteve 1915-1918 (periudha
e bullgarit të parë) . .83
11.1. Perudha gjatë bullgarit të parë (vitet 1915-1918) .84
11.2. Internimi i familjarëve të rekrutëve të likuiduar
nga bullgarët . .88
11.3. Si ishte gjendja e të internuai*ve dhe peripetitë e tyre
në kampet e internimit . 89
12. Komiteti Mbrojtja Kombëtare e Kosovës . . 91
13. Periudha mes viteve 1918 - 1941 . 95
13.1. Rreforma agrare sërbe .107
13.2. Si mbeti epiteti “Smira çivixhi” .109
14. Çka tregon Hamdi Agë Kurteshi-Pozherani
përsmirasit . .111
15. Organizata politike Xhemijeti dhe kontributi i saj
për arsimimin e sniirasve .113
16. Periudha mes viteve 1941-1944 . .113
16.1. Kohae bullgarit të dytë (vitet vitet 1941-1944) .115
16.2. Aktiviteti antiçetnik . .118
16.3. Shpërngulja e familjeve smirase nga zona bull gare
në atë italiane . .120
17. Kontributi i smirasve si efektivë të policisë
në Kontunën e Sllatinës .121
18. Frontet për mbrojten e kufînjve etnikë .123
18.1. Fronti i Kitkës. .124
18.2. Kontributi i Mulla Aliut në mbrojtjen e popullatës
së Preshevës nga njësitet partizano-çetnike . .126
18.3. Fronti i Karadakut .127
18.4. Paisja e vullnetarëve në Frontin e Karadakut .129
18.5. Rezistenca kundër brigadave sërbo-maqedone
më 16 nëntor 1944 .133
19. Smirasit në luftën e Ferizajit .139
20. Formimi i brigadave antifashiste dhe përfshirja
e smirasve në to .141
21. Konferenca e Bujanit .143
226
Sakrificat e popullit shqiptar dhe smirasve per identitet kombetar prej vitit 1868-1999
21.1. Vendimet e Konferences se Bujanit . . . .144
22. Asgjesimi i brigadave etnikisht shqiptare . . .147
23. Smirask e rekrutuar ne Brigaden e IV Kosovare . .151
24. Smirask e rekrutuar ne Brigaden e VII Kosovare .152
25. Smirasit e rekrutuar ne Brigaden e VII
Plotesuese Kosovare . . . . .152
26. Masakra e Tivarit . . . . . .153
27. Popullata e Smires pas formimit te pushtetit
sllavo-komunist ne Viti . . . . .158
28. Luftivnet e OZNA-s kunder atyre qe ishin anti^etnike
dhe antikomuniste . . . . . .159
29. Masat ndeshkuese ekonomike dhe politike
mbi popullaten . . . . . .168
30. Platforma politike . . . . . .169
31. Platforma ekonomike . . . . .171
32. Ramush Mehmet Azemi . . . . .173
33. Burgu i Smires i vitit 1948 . . . . .174
34. Regjistrimi i popuflates per shperngulje ne Turqi .177
35. Si ishte fshehur ne Smire armatimi i rende
kembesorik pas Luftes se Dyte Boterore . . .180
36. Aksioni i grumbullimit te armeve . . . .181
37. Politika shfarosese e RFPJ-se ndaj shqiptareve
gjate viteve 1950-1966 . . . . .186
38. Organizatat kombetare ilegale dhe aksionet e para .189
39. Demonstratat e vitit 1968 . . . . .195
40. Situata politike ne Kosove mes viteve 1968 — 1981 .199
41. Situata politike ne Kosove gjate viteve ‘70 dhe ’80 .201
42. Demonstratat e vitit 1981 . . . . .202
43. Trazirat e viteve 1988 e 1989 . . . .209
44. Ngjarjet e vitit 1990 . . . . . .212
45. Deklarata kushtetuese dhe Kushtetuta e Ka^anikut .213
46. Helmimet e nxenesve. . . . .217
47. Gjendja e shkolles shqipe ne Kosove gjate
viteve te‘90-ta . . . . . .218
48. Kontributi i smirasve gjate viteve 1990-1999 . .222
49. Pajtimi i gjäqeve . . . . . .223
50. Te denuarit politike nga Smira . . . .225
51. Cilat rrethana kane ndikuar ne themelimin e U£K-£se
dhe daljen e saj ne skene . . . . .227
52. Levizja e smirasve per nje force guerile . . .232
Perfundim . . . . . . . .236
Feriz AHMETI
Burimet
Literatura
Informatoret .
Revistat dhe gazetat .
.240
.241
.244
.245
1228
f Bayerische
I Staatsbibliothek
V München
Sakrificat e popullit shqiptar dhe smirasve per identitet kombetar prej vitit 1868-1999
LITERATURA
1. Bajrami, dr. Hakif, Rrethanat shoqëroro -politike ne Kosovë,
1918-1941, Prishtnë, 1981.
2. Bajrami, dr. Hakif, Si e okupoi Sërhia Kosovën 1912,
Prishtinë, 2003.
3. Bajrami, dr. Hakif, Kosova, Njëzet shekuj të identitetit të
saj,Prishtine, 2001.
4. Bajrami, dr. Hakif, Bedri Pejani, Një jetë e një vdekje për
Shqipërinë etnike 1885 - 1946, Prishtinë, 1994.
5. Brestovci, Sadulla, Lëvizja Kombëtare Shqiptare në Kosovë e
Gjilan, Islam Pira,RiUndja, 09.6. 1971.
6. Bajrami, Muharrem, Batalioni Kosovar i Rinisë, Gjilan, 2006.
7. Bislimi dr., Daut, Shqiponjat e 10 Gus h lit, Prishtinë, 2000.
8. Luzha, Berat, Një historipër Sulë Durmishin, Prishtinë, 2006.
9. Culaj, mr. Lush, Komiteti Mbrojtja Kombëtare e Kosovës,
Prishtinë, 1997.
10. Frashëri, Kristo, Rilindja Kombëtare Shqiptare, Tiranë.
11. Hadri, dr. A\\,LNÇ, në Kosovë 1941-1945, Prishtinë, 1971.
12. Halimi, dr. Mehmet, Kështu fliste babai im,Prishtinë, 1974.
13. Halimi, dr. Mehmet, Mehmet Gjevori, Flakadan i Arsimit
Kombëtar, 2010.
14. Halimi, dr. Mehmet, Kërkime dialektologjike, Prishtinë, 1985.
15. Halimi, Afërdita Cërnica, Raif Halimi Cënica, Tiranë, 2000.
16. ***: Historia Covjecanstva, Zagreb. 1966.
17. ***; Historia e Popullit Shqiptar, -//- Prishtinë, 1969.
18. ***: Historia e Popullit Shqiptar, për Shkollat e mesme,
Prishtinë.
19. Keçmezi, dr Sabile Basha,Makaber mes Shqiptarëve, Bujku,
11.06.1998.
20. Keçmezi, dr Sabile Basha, Shtypi Ilegal Shqiptar në Kosovë
(1945-1999),Prishtinë, 2009.
21. Krasniqi, dr. Mark, Gjurmë dhe Gjurmime, Prishtinë, 1997.
22. Krasniqi, dr. Mark, Nga Gurra e Traditës, Prishtinë, 1991.
23. ***: Kosova Dikur dhe Sot, Beograd, 1973.
24. Kurtaj, Hajrush, Shungullon Gryka e Kaçanikut, Prishtinë,
2000.
25. Kurtaj, mr. Sc. Hajrush, Lufta e UÇK-ësë në ZON, Prishtinë,
2012.
221
Feriz AHMETI
26. Mirdita, dr Zef, Dardania Antike,
27. Murati, mr Adern, Ramadan Agushi, Veprimtar i Lévizjes per
Bashkimin e Shqipérisé Etnike (1919-1991), Prishtine, 2003.
28. Murati, mr Adern, Lévizja Kombetare per Arsimin Shqip,
Mulla Syla, Mesues dhe veprimtar i dalluar, Prishtine.
29. Obradoviq, dr. Millovan, Agrama reforma i kolonizacija
Kosova, 1918-1941, Prishtine, 1981.
30. Osmani, dr. Jusuf, Lénda arkivore per kolonizimin dhe
reformen agrare ne Kosové 1918-1941, Prishtine, 1996.
31. Osmani, dr. Jusuf, Kolnizimi serb i Kosovés,Prishtine, 2000.
32. Osmani, dr Jusuf, Vendbanimet e Kosovés-7. Vitia, Prishtine,
2004.
33. Osmani, dr. Jusuf, Mitrovica dhe Diplomacia Ruso-Sérbe,
1901-1903, Prishtine , 2009.
34. Osmani, dr. Jusuf, Vrasjet ne Präge e Cena ßeut-1927 dhe
Alquviadh Beut 1928, Prishtine, 1997.
35. Papazoglu, Dr, Fanuia, Dardanska Kralevina, Beograd.
36. Pulaha Selami, Populista Shqiptare e Kosov es gjaté shek, XV-
XVI; Tirane, 1984.
37. Rexha, Mr. Ilaz, Lidhja e Prizrenit ne dokumentet osmane,
1878-1881, Prishtine, 1978.
38. Rexhepi, Fehmi, Kosova nr. 7.
39. ***: Recnik Mesta u oslobodjenoj oblasti Stare Serbije,
Beograd, 1914.
40. ***; Recnik Mesta Kralevine Serbije, Beograd, 1925.
41. Rahimi, dr. Shukri, Vilajeti i Kosoves, Prishtine, 1969.
42. Rahimi, dr. Shukri, Kryengritjet Shqiptare té vitit 1908,
Kosova nr. 17.
43. Senkij eviq, Dvizenje Albanskog Naroda.
44. Shukriu, dr. Edi, Stella nga Smira dhe Gradina e Goshices,
Gjurmime Albanogjike. Seria e Shkencave Historike, nr.
20/1990.
45. Meta, Ilaz - Llunji, Ali, Hysen Térpeza Histori e gjallé,
Prishtine, 1992.
46. Uka, dr. Sabit, Shpemgulja e Shqiptaréve té Sanxhakut té
Nishit 1877/78, Prishtine, 1994, libri 1 dhe 2.
47. Uka, dr, Sabit, Vendosja dhe Pozita e shqiptaréve né Kosové
1878-1912, libri 3-4. Prishtine, 1996.
48. Urosheviq Atanasije, Juzna Morava i Izvmornik,Beograd,
1935.
222
Sakrificat e popullit shqiptar dhe smirasve per identitet kombetar prej vitit 1868-1999
CONCLUSION
In this chronology of historical events of Albanian people through
the centuries for challenges, sacrifices, bravery, praises and heroism of
Albanian people smirasit were undivided against foreign invaders.
First I was inexperienced in this field, but then I enrolled in Pedagogical
Academy in Skopje in the department of history-geography, the
historian-academician Shukri Rrahimi order me to talk with the old men
which had experienced many historical events and they were the source
of history. I finished this duty by order. I talked with some participants
of the Albanian uprisings of 1908-1912, but I also wrote about memories
of my grandfather who narrated about the war of Plema e Vogel of 1878
that his father and a lot of Albanians had been killed in defense of ethnic
territories.
My will and obligation were so great because I owned this to the fallen
of my hometown and other Albanians who had fallen for national
identity. On the other side, I was conscious of leaving something in
writing because words will be forgotten and writings will remain even
after our death. I am conscious that this book can have possible
shortcomings, omissions and mistakes so I apologize from the honored
readers and researchers, welcoming remarks, proposals, and suggestions
that complete my book and advance historical knowledge for challenges
and sacrifices of Albanian people in the stages of history.
In this book, I have tried to describe in details the bitter past of the
population of Smira through the centuries.
In the second half of the XIX century, all Albanian intellectuals were
educated in various centers of the Ottoman Empire, but also in other
centers. In order to self-built national consciousness, they had organized
the formation of Albanian clubs in all centers of ethnic territories. The
most active club was the club of Istanbul. During the east crisis, the
national conscience felt the need for advancement of the club in the
Committee of Istanbul headed by Abdyl bej Frasheri.
This committee calls on all Albanian territories clubs to mobilize and
inform the Albanian people that Albanian lands are threatened by Slavic
states.
Requirements of this committee were National Identity and education of
the nation. National Identity was to unite all Albanian territories in one
217
Feriz AHMETI
state (autonomy) under the sovereignty of the Sultan and to open
Albanian schools with an Albanian alphabet
During 1877/78 Tsarist Russia and other Balkan countries begin the
attack on the Ottoman Empire and to capture Albanian territories.
National conscience requires protection of ethnic territories. In the
protection of ethnic borders participate a lot of Albanian some of them
killed and wounded. From Smira have been six killed and one wounded.
In these circumstances the National conscience organized the First
Albanian League in Prizren, on June 10,1878 it did not find support
from the European powers but it was directed by Albanian population to
help with people, weapons, and gold.
From the appeal of the Albanian League for the protection of ethnic
territories and National Identity since 1878 to 1912 from Smira were
killed 19 residents and some were wounded.
After the conquest of Kosovo Vilayet from Russian-Slavic invaders on
27/28 October 1912, in Smire were massacred 73 people, old and
young were are not spared either the crippled.
Serbian monarchy during the years 1912-1915 changed the
extermination program of Albanians of Smira, it stopped killing people
publicly and started to rehouse many families (even in Anatolia,
Turkey), the fate of these families is unknown. In their homes and
properties were placed families of “deserved Serbs”.
The First World War did not bring Albanian people any benefit, on the
contrary, it witnessed the invasion of foreign invaders, whereas smirasit
passed through Slavic-Serbian invasion in that Slavic-Bulgarian
invasion. Even this invader implemented Slavic programs for the
extermination of Albanians, during the years 1915-1918. From this
invader ,many smiras were executed and exiled. Some families were
eradicated, exiled and some never returned to the homeland. From this
invader are killed, executed and eradicated over 59 smiras. The next
invader from 1918-1941 was S.K.S monarchy.
This monarchy operated by the program of Academy of Sciences of
Serbia for an extermination of Albanians.
Committed genocide against smiraseve by eliminating them from all
human rights made economic reforms by occupying the Land of
smiraseve and giving them to Serbian colonists. Made the resettlement
of the Kosovars in Turkey and Albanian and imprisoned many people,
more than six smiras were killed.
21S
Sakrificat e popullit shqiptar dhe smirasve per identitet kombetar prej vitit 1868-1999
During the Second World War, 1941-1944 there was hope for
Albanians, but the village of Smira and some other villages remained
under the rule of fascist Bulgaria. This Slavic-fascist power made
genocide against the population, killingdooting, interments and other
forms of genocide. In the half of 1944 Bulgaria capitulates and
Albanians with the assistance of Germany formed the ethnic Albania.
During this time the anti-fascist alliance appealed that every nation that
joins this alliance has the right to acquire self-determination. Albanian
partisans join the anti-fascist alliance and liberate the country, but
betrayed by Yugoslavia. The Albanians of Kosovo have collaborated
with fascism and communism in order to reach up to an independent
state but unfortunately did not succeed in anything.
Albanians of Kosovo never reconciled with Serbian-Slavic authorities
and have organized revolutionary groups, demonstrations and finally the
formation of KLA with symbols and uniform as the army of a nation
which fights for freedom. KLA with the assistance of the
Albanian people, ahead and beyond the current border, as well as
international friends on top with the USA, liberated Kosovo.
Today Kosovo is an independent and sovereign state.
Prof. Majlinda Ukshini
2191 |
any_adam_object | 1 |
author | Ahmeti, Feriz 1944- |
author_GND | (DE-588)1122509057 |
author_facet | Ahmeti, Feriz 1944- |
author_role | aut |
author_sort | Ahmeti, Feriz 1944- |
author_variant | f a fa |
building | Verbundindex |
bvnumber | BV043982737 |
ctrlnum | (OCoLC)968704371 (DE-599)BVBBV043982737 |
era | Geschichte 1868-1999 gnd |
era_facet | Geschichte 1868-1999 |
format | Book |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>00000nam a2200000 c 4500</leader><controlfield tag="001">BV043982737</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="007">t|</controlfield><controlfield tag="008">161230s2016 xx ac|| |||| 00||| alb d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9789951697095</subfield><subfield code="9">978-9951-697-09-5</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)968704371</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV043982737</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">alb</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">7,41</subfield><subfield code="2">ssgn</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Ahmeti, Feriz</subfield><subfield code="d">1944-</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1122509057</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Sakrificat e popullit shqiptar dhe smirasve për identitet kombëtar gjatë viteve 1868-1999</subfield><subfield code="c">Feriz Ahmeti</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Prishtinë</subfield><subfield code="b">Armagedoni</subfield><subfield code="c">2016</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">228 Seiten</subfield><subfield code="b">Illustrationen, Portrtäts, Karten</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="546" ind1=" " ind2=" "><subfield code="a">Zusammenfassung in englischer Sprache</subfield></datafield><datafield tag="610" ind1="2" ind2="7"><subfield code="a">Ushtria Çlirimtare e Kosovës</subfield><subfield code="0">(DE-588)4549901-9</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte 1868-1999</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Unabhängigkeitsbewegung</subfield><subfield code="0">(DE-588)4121814-0</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Erster Weltkrieg</subfield><subfield code="0">(DE-588)4079163-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Nationalbewusstsein</subfield><subfield code="0">(DE-588)4041282-9</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Zweiter Weltkrieg</subfield><subfield code="0">(DE-588)4079167-1</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Kosovo-Krieg</subfield><subfield code="0">(DE-588)4547508-8</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Albaner</subfield><subfield code="0">(DE-588)4068517-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Albanischer Aufstand</subfield><subfield code="g">1910</subfield><subfield code="0">(DE-588)1028274998</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Smirë</subfield><subfield code="0">(DE-588)1122509014</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Kosovo</subfield><subfield code="0">(DE-588)4032571-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Kosovo</subfield><subfield code="0">(DE-588)4032571-4</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Smirë</subfield><subfield code="0">(DE-588)1122509014</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Albaner</subfield><subfield code="0">(DE-588)4068517-2</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Unabhängigkeitsbewegung</subfield><subfield code="0">(DE-588)4121814-0</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="4"><subfield code="a">Nationalbewusstsein</subfield><subfield code="0">(DE-588)4041282-9</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="5"><subfield code="a">Geschichte 1868-1999</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="1" ind2="0"><subfield code="a">Smirë</subfield><subfield code="0">(DE-588)1122509014</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="1" ind2="1"><subfield code="a">Albanischer Aufstand</subfield><subfield code="g">1910</subfield><subfield code="0">(DE-588)1028274998</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="2"><subfield code="a">Erster Weltkrieg</subfield><subfield code="0">(DE-588)4079163-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="3"><subfield code="a">Zweiter Weltkrieg</subfield><subfield code="0">(DE-588)4079167-1</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="4"><subfield code="a">Kosovo-Krieg</subfield><subfield code="0">(DE-588)4547508-8</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="5"><subfield code="a">Ushtria Çlirimtare e Kosovës</subfield><subfield code="0">(DE-588)4549901-9</subfield><subfield code="D">b</subfield></datafield><datafield tag="689" ind1="1" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029391133&sequence=000004&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029391133&sequence=000005&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Literaturverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029391133&sequence=000006&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Abstract</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">oe</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">BSBWK1</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">909</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09034</subfield><subfield code="g">4975</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">307.09</subfield><subfield code="e">22/bsb</subfield><subfield code="f">0904</subfield><subfield code="g">4975</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">307.09</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09034</subfield><subfield code="g">4975</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">909</subfield><subfield code="e">22/bsb</subfield><subfield code="f">0904</subfield><subfield code="g">4975</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">355.009</subfield><subfield code="e">22/bsb</subfield><subfield code="f">0904</subfield><subfield code="g">4975</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">355.009</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09034</subfield><subfield code="g">4975</subfield></datafield><datafield tag="943" ind1="1" ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-029391133</subfield></datafield></record></collection> |
geographic | Smirë (DE-588)1122509014 gnd Kosovo (DE-588)4032571-4 gnd |
geographic_facet | Smirë Kosovo |
id | DE-604.BV043982737 |
illustrated | Illustrated |
indexdate | 2024-12-04T11:01:45Z |
institution | BVB |
isbn | 9789951697095 |
language | Albanian |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-029391133 |
oclc_num | 968704371 |
open_access_boolean | |
owner | DE-12 |
owner_facet | DE-12 |
physical | 228 Seiten Illustrationen, Portrtäts, Karten |
psigel | BSBWK1 |
publishDate | 2016 |
publishDateSearch | 2016 |
publishDateSort | 2016 |
publisher | Armagedoni |
record_format | marc |
spelling | Ahmeti, Feriz 1944- Verfasser (DE-588)1122509057 aut Sakrificat e popullit shqiptar dhe smirasve për identitet kombëtar gjatë viteve 1868-1999 Feriz Ahmeti Prishtinë Armagedoni 2016 228 Seiten Illustrationen, Portrtäts, Karten txt rdacontent n rdamedia nc rdacarrier Zusammenfassung in englischer Sprache Ushtria Çlirimtare e Kosovës (DE-588)4549901-9 gnd rswk-swf Geschichte 1868-1999 gnd rswk-swf Unabhängigkeitsbewegung (DE-588)4121814-0 gnd rswk-swf Erster Weltkrieg (DE-588)4079163-4 gnd rswk-swf Nationalbewusstsein (DE-588)4041282-9 gnd rswk-swf Zweiter Weltkrieg (DE-588)4079167-1 gnd rswk-swf Kosovo-Krieg (DE-588)4547508-8 gnd rswk-swf Albaner (DE-588)4068517-2 gnd rswk-swf Albanischer Aufstand 1910 (DE-588)1028274998 gnd rswk-swf Smirë (DE-588)1122509014 gnd rswk-swf Kosovo (DE-588)4032571-4 gnd rswk-swf Kosovo (DE-588)4032571-4 g Smirë (DE-588)1122509014 g Albaner (DE-588)4068517-2 s Unabhängigkeitsbewegung (DE-588)4121814-0 s Nationalbewusstsein (DE-588)4041282-9 s Geschichte 1868-1999 z DE-604 Albanischer Aufstand 1910 (DE-588)1028274998 s Erster Weltkrieg (DE-588)4079163-4 s Zweiter Weltkrieg (DE-588)4079167-1 s Kosovo-Krieg (DE-588)4547508-8 s Ushtria Çlirimtare e Kosovës (DE-588)4549901-9 b Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029391133&sequence=000004&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029391133&sequence=000005&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA Literaturverzeichnis Digitalisierung BSB Muenchen 19 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029391133&sequence=000006&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA Abstract |
spellingShingle | Ahmeti, Feriz 1944- Sakrificat e popullit shqiptar dhe smirasve për identitet kombëtar gjatë viteve 1868-1999 Ushtria Çlirimtare e Kosovës (DE-588)4549901-9 gnd Unabhängigkeitsbewegung (DE-588)4121814-0 gnd Erster Weltkrieg (DE-588)4079163-4 gnd Nationalbewusstsein (DE-588)4041282-9 gnd Zweiter Weltkrieg (DE-588)4079167-1 gnd Kosovo-Krieg (DE-588)4547508-8 gnd Albaner (DE-588)4068517-2 gnd Albanischer Aufstand 1910 (DE-588)1028274998 gnd |
subject_GND | (DE-588)4549901-9 (DE-588)4121814-0 (DE-588)4079163-4 (DE-588)4041282-9 (DE-588)4079167-1 (DE-588)4547508-8 (DE-588)4068517-2 (DE-588)1028274998 (DE-588)1122509014 (DE-588)4032571-4 |
title | Sakrificat e popullit shqiptar dhe smirasve për identitet kombëtar gjatë viteve 1868-1999 |
title_auth | Sakrificat e popullit shqiptar dhe smirasve për identitet kombëtar gjatë viteve 1868-1999 |
title_exact_search | Sakrificat e popullit shqiptar dhe smirasve për identitet kombëtar gjatë viteve 1868-1999 |
title_full | Sakrificat e popullit shqiptar dhe smirasve për identitet kombëtar gjatë viteve 1868-1999 Feriz Ahmeti |
title_fullStr | Sakrificat e popullit shqiptar dhe smirasve për identitet kombëtar gjatë viteve 1868-1999 Feriz Ahmeti |
title_full_unstemmed | Sakrificat e popullit shqiptar dhe smirasve për identitet kombëtar gjatë viteve 1868-1999 Feriz Ahmeti |
title_short | Sakrificat e popullit shqiptar dhe smirasve për identitet kombëtar gjatë viteve 1868-1999 |
title_sort | sakrificat e popullit shqiptar dhe smirasve per identitet kombetar gjate viteve 1868 1999 |
topic | Ushtria Çlirimtare e Kosovës (DE-588)4549901-9 gnd Unabhängigkeitsbewegung (DE-588)4121814-0 gnd Erster Weltkrieg (DE-588)4079163-4 gnd Nationalbewusstsein (DE-588)4041282-9 gnd Zweiter Weltkrieg (DE-588)4079167-1 gnd Kosovo-Krieg (DE-588)4547508-8 gnd Albaner (DE-588)4068517-2 gnd Albanischer Aufstand 1910 (DE-588)1028274998 gnd |
topic_facet | Ushtria Çlirimtare e Kosovës Unabhängigkeitsbewegung Erster Weltkrieg Nationalbewusstsein Zweiter Weltkrieg Kosovo-Krieg Albaner Albanischer Aufstand 1910 Smirë Kosovo |
url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029391133&sequence=000004&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029391133&sequence=000005&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029391133&sequence=000006&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA |
work_keys_str_mv | AT ahmetiferiz sakrificatepopullitshqiptardhesmirasveperidentitetkombetargjateviteve18681999 |