Advanced research on mechanics, manufacturing engineering and applied technology II: selected, peer reviewed papers from the 2nd International Conference on Applied Mechanics and Manufacturing System (AMMS 2014), April 26-27, 2014, Zhengzhou, China
Gespeichert in:
| Körperschaft: | |
|---|---|
| Weitere Verfasser: | , , |
| Format: | Elektronisch Tagungsbericht E-Book |
| Sprache: | English |
| Veröffentlicht: |
Durnten-Zurich
Trans Tech Publications
[2014]
|
| Schriftenreihe: | Applied mechanics and materials
540 |
| Schlagworte: | |
| Online-Zugang: | FAW01 FAW02 |
| Beschreibung: | Print version record |
| Beschreibung: | 1 online resource |
| ISBN: | 9783038264767 3038264768 3038350958 9783038350958 |
Internformat
MARC
| LEADER | 00000nmm a2200000zcb4500 | ||
|---|---|---|---|
| 001 | BV043781458 | ||
| 003 | DE-604 | ||
| 005 | 20180205 | ||
| 006 | a |||| 10||| | ||
| 007 | cr|uuu---uuuuu | ||
| 008 | 160920s2014 |||| o||u| ||||||eng d | ||
| 020 | |a 9783038264767 |9 978-3-03826-476-7 | ||
| 020 | |a 3038264768 |9 3-03826-476-8 | ||
| 020 | |a 3038350958 |9 3-03835-095-8 | ||
| 020 | |a 9783038350958 |9 978-3-03835-095-8 | ||
| 035 | |a (ZDB-4-EBA)ocn881732878 | ||
| 035 | |a (OCoLC)881732878 | ||
| 035 | |a (DE-599)BVBBV043781458 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-1046 |a DE-1047 | ||
| 082 | 0 | |a 621 |2 23 | |
| 111 | 2 | |a International Conference on Applied Mechanics and Manufacturing System |n 2 |d 2014 |c Zhengzhou |j Verfasser |0 (DE-588)1053309597 |4 aut | |
| 245 | 1 | 0 | |a Advanced research on mechanics, manufacturing engineering and applied technology II |b selected, peer reviewed papers from the 2nd International Conference on Applied Mechanics and Manufacturing System (AMMS 2014), April 26-27, 2014, Zhengzhou, China |c edited by Helen Zhang, David Jin and X.J. Zhao |
| 264 | 1 | |a Durnten-Zurich |b Trans Tech Publications |c [2014] | |
| 264 | 4 | |c © 2014 | |
| 300 | |a 1 online resource | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b c |2 rdamedia | ||
| 338 | |b cr |2 rdacarrier | ||
| 490 | 1 | |a Applied mechanics and materials |v v. 540 | |
| 500 | |a Print version record | ||
| 505 | 8 | |a Advanced Research on Mechanics, Manufacturing Engineering and Applied Technology II; Preface and Committee; Table of Contents; Chapter 1: Materials Science and Processing; The Luminescence Mechanism and the Structure Defects of ZnO Thin Films; Synthesis of Porous Spheres of TiO2 Nanoparticles and its Photocatalysis Behavior for 1-Naphthylamine-4-Azobenzene-4'-Sulfonic Acid; Effects of Substrate Preheating on Microstructure and Interface Characterization of Al2O3-13% TiO2 Ceramic Coating Fabricated by Laser Cladding | |
| 505 | 8 | |a Preparation and Characterization of Plasma-Sprayed and Laser-Remelted Ni60/Ni-WC Coatings Preparation and Properties of Ag Nanofilms for Organic Solar Cells; Effects of Substrate Temperature on Structure and Optical Property of Cu2O:N Thin Film Deposited by Reactive Pulse Magnetron Sputtering; Research on Chemical Materials with Characteristic on Chemical Looping Combustion of Co-Doped Fe2O3 Oxygen Carrier with CO; Research of Hydrogen Atom Penetration during the Phosphorization Process of High-Strength Steel | |
| 505 | 8 | |a The Constitutive Model of Solid Ice and Snow with Material Properties Based on the Microscopic Mechanical DeformationExperimental Analysis on Fracture Characteristics and Material Properties of Compacted Ice and Snow; The Test of Aircraft Material with Performance Parameters; Study on Composite Materials Used in the Tennis Racket; The Way of Obtain C4H6O+ Macro Ion by C7H12O+ Excited State; Study on the Preparation of WO3/TiO2 Composite Photocatalyst and its Photocatalytic Activity | |
| 505 | 8 | |a Research on Refractory Material with Influence of Polyethylene Glycol (PEG) 6000 on the Properties of Lubricant for Slide PlateAnalysis of Micro Inclusions in Q195 Steel; The Research on Three-Dimensional Theoretical Model of Residual Stress on Cutting Surface; Chapter 2: Research and Design in Mechanical Engineering; Study of Lateral Tuyere Layout Impact on the Inner Velocity and Temperature Field of Dry Slag Discharge Machine; Research on the Transmission Characteristics and Mechanical Mechanics of Dual Meshing Points in Involute-Circular Arc Tooth Gear | |
| 505 | 8 | |a Simulation and Analysis about Different Pressure Angle in Involute Gears Based on Neural NetworkResearch on Involute Gear Undercutting with Mechanical Mechanics Based on Neural Network; The Localization of the Wind Turbine Passive Spindle Brake Based on Mechanical Mechanics; A 3D Computation of Fluid-Structure Interaction in a Cyclone Separator; Performance Analysis of Two Stage Compression Cycle with an Internal Heat Exchanger; The Research on Characteristics of a New Type of Marine Gas Turbine Exhaust Ejector Device; The Design of DC/DC Converter for Battery System in Electric Vehicle | |
| 505 | 8 | |a Collection of selected, peer reviewed papers from the 2014 2nd International Conference on Applied Mechanics and Manufacturing System (AMMS2014), April 26-27, 2014, Zhengzhou, China. The 125 papers are grouped as follows: Chapter 1: Materials Science and Processing, Chapter 2: Research and Design in Mechanical Engineering, Chapter 3: Construction Technologies and Materials, Chapter 4: Environmental Engineering, Chapter 5: Oil and Mining Engineering and Manufacturing, Chapter 6: Biomechanics, Biomaterials and Biomedicine, Chapter 7: Robotics, Control and Automation, Chapter 8: Applied Informati | |
| 650 | 7 | |a TECHNOLOGY & ENGINEERING / Mechanical |2 bisacsh | |
| 650 | 7 | |a Mechanical engineering / Research |2 fast | |
| 650 | 7 | |a Production engineering / Research |2 fast | |
| 650 | 4 | |a Mechanical engineering |x Research |v Congresses |a Production engineering |x Research |v Congresses | |
| 655 | 7 | |0 (DE-588)1071861417 |a Konferenzschrift |2 gnd-content | |
| 700 | 1 | |a Zhang, Helen |4 edt | |
| 700 | 1 | |a Jin, David |4 edt | |
| 700 | 1 | |a Zhao, X. J. |4 edt | |
| 776 | 0 | 8 | |i Erscheint auch als |n Druck-Ausgabe |a Advanced research on mechanics, manufacturing engineering and applied |
| 830 | 0 | |a Applied mechanics and materials |v 540 |w (DE-604)BV040665233 |9 540 | |
| 912 | |a ZDB-4-EBA | ||
| 999 | |a oai:aleph.bib-bvb.de:BVB01-029192518 | ||
| 966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=773243 |l FAW01 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext | |
| 966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=773243 |l FAW02 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext | |
Datensatz im Suchindex
| _version_ | 1804176611980869632 |
|---|---|
| any_adam_object | |
| author2 | Zhang, Helen Jin, David Zhao, X. J. |
| author2_role | edt edt edt |
| author2_variant | h z hz d j dj x j z xj xjz |
| author_corporate | International Conference on Applied Mechanics and Manufacturing System Zhengzhou |
| author_corporate_role | aut |
| author_facet | Zhang, Helen Jin, David Zhao, X. J. International Conference on Applied Mechanics and Manufacturing System Zhengzhou |
| author_sort | International Conference on Applied Mechanics and Manufacturing System Zhengzhou |
| building | Verbundindex |
| bvnumber | BV043781458 |
| collection | ZDB-4-EBA |
| contents | Advanced Research on Mechanics, Manufacturing Engineering and Applied Technology II; Preface and Committee; Table of Contents; Chapter 1: Materials Science and Processing; The Luminescence Mechanism and the Structure Defects of ZnO Thin Films; Synthesis of Porous Spheres of TiO2 Nanoparticles and its Photocatalysis Behavior for 1-Naphthylamine-4-Azobenzene-4'-Sulfonic Acid; Effects of Substrate Preheating on Microstructure and Interface Characterization of Al2O3-13% TiO2 Ceramic Coating Fabricated by Laser Cladding Preparation and Characterization of Plasma-Sprayed and Laser-Remelted Ni60/Ni-WC Coatings Preparation and Properties of Ag Nanofilms for Organic Solar Cells; Effects of Substrate Temperature on Structure and Optical Property of Cu2O:N Thin Film Deposited by Reactive Pulse Magnetron Sputtering; Research on Chemical Materials with Characteristic on Chemical Looping Combustion of Co-Doped Fe2O3 Oxygen Carrier with CO; Research of Hydrogen Atom Penetration during the Phosphorization Process of High-Strength Steel The Constitutive Model of Solid Ice and Snow with Material Properties Based on the Microscopic Mechanical DeformationExperimental Analysis on Fracture Characteristics and Material Properties of Compacted Ice and Snow; The Test of Aircraft Material with Performance Parameters; Study on Composite Materials Used in the Tennis Racket; The Way of Obtain C4H6O+ Macro Ion by C7H12O+ Excited State; Study on the Preparation of WO3/TiO2 Composite Photocatalyst and its Photocatalytic Activity Research on Refractory Material with Influence of Polyethylene Glycol (PEG) 6000 on the Properties of Lubricant for Slide PlateAnalysis of Micro Inclusions in Q195 Steel; The Research on Three-Dimensional Theoretical Model of Residual Stress on Cutting Surface; Chapter 2: Research and Design in Mechanical Engineering; Study of Lateral Tuyere Layout Impact on the Inner Velocity and Temperature Field of Dry Slag Discharge Machine; Research on the Transmission Characteristics and Mechanical Mechanics of Dual Meshing Points in Involute-Circular Arc Tooth Gear Simulation and Analysis about Different Pressure Angle in Involute Gears Based on Neural NetworkResearch on Involute Gear Undercutting with Mechanical Mechanics Based on Neural Network; The Localization of the Wind Turbine Passive Spindle Brake Based on Mechanical Mechanics; A 3D Computation of Fluid-Structure Interaction in a Cyclone Separator; Performance Analysis of Two Stage Compression Cycle with an Internal Heat Exchanger; The Research on Characteristics of a New Type of Marine Gas Turbine Exhaust Ejector Device; The Design of DC/DC Converter for Battery System in Electric Vehicle Collection of selected, peer reviewed papers from the 2014 2nd International Conference on Applied Mechanics and Manufacturing System (AMMS2014), April 26-27, 2014, Zhengzhou, China. The 125 papers are grouped as follows: Chapter 1: Materials Science and Processing, Chapter 2: Research and Design in Mechanical Engineering, Chapter 3: Construction Technologies and Materials, Chapter 4: Environmental Engineering, Chapter 5: Oil and Mining Engineering and Manufacturing, Chapter 6: Biomechanics, Biomaterials and Biomedicine, Chapter 7: Robotics, Control and Automation, Chapter 8: Applied Informati |
| ctrlnum | (ZDB-4-EBA)ocn881732878 (OCoLC)881732878 (DE-599)BVBBV043781458 |
| dewey-full | 621 |
| dewey-hundreds | 600 - Technology (Applied sciences) |
| dewey-ones | 621 - Applied physics |
| dewey-raw | 621 |
| dewey-search | 621 |
| dewey-sort | 3621 |
| dewey-tens | 620 - Engineering and allied operations |
| format | Electronic Conference Proceeding eBook |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>05778nmm a2200589zcb4500</leader><controlfield tag="001">BV043781458</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20180205 </controlfield><controlfield tag="006">a |||| 10||| </controlfield><controlfield tag="007">cr|uuu---uuuuu</controlfield><controlfield tag="008">160920s2014 |||| o||u| ||||||eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038264767</subfield><subfield code="9">978-3-03826-476-7</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3038264768</subfield><subfield code="9">3-03826-476-8</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3038350958</subfield><subfield code="9">3-03835-095-8</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038350958</subfield><subfield code="9">978-3-03835-095-8</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ZDB-4-EBA)ocn881732878</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)881732878</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV043781458</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-1046</subfield><subfield code="a">DE-1047</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">621</subfield><subfield code="2">23</subfield></datafield><datafield tag="111" ind1="2" ind2=" "><subfield code="a">International Conference on Applied Mechanics and Manufacturing System</subfield><subfield code="n">2</subfield><subfield code="d">2014</subfield><subfield code="c">Zhengzhou</subfield><subfield code="j">Verfasser</subfield><subfield code="0">(DE-588)1053309597</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Advanced research on mechanics, manufacturing engineering and applied technology II</subfield><subfield code="b">selected, peer reviewed papers from the 2nd International Conference on Applied Mechanics and Manufacturing System (AMMS 2014), April 26-27, 2014, Zhengzhou, China</subfield><subfield code="c">edited by Helen Zhang, David Jin and X.J. Zhao</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Durnten-Zurich</subfield><subfield code="b">Trans Tech Publications</subfield><subfield code="c">[2014]</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">© 2014</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Applied mechanics and materials</subfield><subfield code="v">v. 540</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Print version record</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Advanced Research on Mechanics, Manufacturing Engineering and Applied Technology II; Preface and Committee; Table of Contents; Chapter 1: Materials Science and Processing; The Luminescence Mechanism and the Structure Defects of ZnO Thin Films; Synthesis of Porous Spheres of TiO2 Nanoparticles and its Photocatalysis Behavior for 1-Naphthylamine-4-Azobenzene-4'-Sulfonic Acid; Effects of Substrate Preheating on Microstructure and Interface Characterization of Al2O3-13% TiO2 Ceramic Coating Fabricated by Laser Cladding</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Preparation and Characterization of Plasma-Sprayed and Laser-Remelted Ni60/Ni-WC Coatings Preparation and Properties of Ag Nanofilms for Organic Solar Cells; Effects of Substrate Temperature on Structure and Optical Property of Cu2O:N Thin Film Deposited by Reactive Pulse Magnetron Sputtering; Research on Chemical Materials with Characteristic on Chemical Looping Combustion of Co-Doped Fe2O3 Oxygen Carrier with CO; Research of Hydrogen Atom Penetration during the Phosphorization Process of High-Strength Steel</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">The Constitutive Model of Solid Ice and Snow with Material Properties Based on the Microscopic Mechanical DeformationExperimental Analysis on Fracture Characteristics and Material Properties of Compacted Ice and Snow; The Test of Aircraft Material with Performance Parameters; Study on Composite Materials Used in the Tennis Racket; The Way of Obtain C4H6O+ Macro Ion by C7H12O+ Excited State; Study on the Preparation of WO3/TiO2 Composite Photocatalyst and its Photocatalytic Activity</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Research on Refractory Material with Influence of Polyethylene Glycol (PEG) 6000 on the Properties of Lubricant for Slide PlateAnalysis of Micro Inclusions in Q195 Steel; The Research on Three-Dimensional Theoretical Model of Residual Stress on Cutting Surface; Chapter 2: Research and Design in Mechanical Engineering; Study of Lateral Tuyere Layout Impact on the Inner Velocity and Temperature Field of Dry Slag Discharge Machine; Research on the Transmission Characteristics and Mechanical Mechanics of Dual Meshing Points in Involute-Circular Arc Tooth Gear</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Simulation and Analysis about Different Pressure Angle in Involute Gears Based on Neural NetworkResearch on Involute Gear Undercutting with Mechanical Mechanics Based on Neural Network; The Localization of the Wind Turbine Passive Spindle Brake Based on Mechanical Mechanics; A 3D Computation of Fluid-Structure Interaction in a Cyclone Separator; Performance Analysis of Two Stage Compression Cycle with an Internal Heat Exchanger; The Research on Characteristics of a New Type of Marine Gas Turbine Exhaust Ejector Device; The Design of DC/DC Converter for Battery System in Electric Vehicle</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Collection of selected, peer reviewed papers from the 2014 2nd International Conference on Applied Mechanics and Manufacturing System (AMMS2014), April 26-27, 2014, Zhengzhou, China. The 125 papers are grouped as follows: Chapter 1: Materials Science and Processing, Chapter 2: Research and Design in Mechanical Engineering, Chapter 3: Construction Technologies and Materials, Chapter 4: Environmental Engineering, Chapter 5: Oil and Mining Engineering and Manufacturing, Chapter 6: Biomechanics, Biomaterials and Biomedicine, Chapter 7: Robotics, Control and Automation, Chapter 8: Applied Informati</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING / Mechanical</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Mechanical engineering / Research</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Production engineering / Research</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Mechanical engineering</subfield><subfield code="x">Research</subfield><subfield code="v">Congresses</subfield><subfield code="a">Production engineering</subfield><subfield code="x">Research</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)1071861417</subfield><subfield code="a">Konferenzschrift</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Zhang, Helen</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Jin, David</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Zhao, X. J.</subfield><subfield code="4">edt</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Druck-Ausgabe</subfield><subfield code="a">Advanced research on mechanics, manufacturing engineering and applied</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Applied mechanics and materials</subfield><subfield code="v">540</subfield><subfield code="w">(DE-604)BV040665233</subfield><subfield code="9">540</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-029192518</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=773243</subfield><subfield code="l">FAW01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=773243</subfield><subfield code="l">FAW02</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield></record></collection> |
| genre | (DE-588)1071861417 Konferenzschrift gnd-content |
| genre_facet | Konferenzschrift |
| id | DE-604.BV043781458 |
| illustrated | Not Illustrated |
| indexdate | 2024-07-10T07:34:57Z |
| institution | BVB |
| institution_GND | (DE-588)1053309597 |
| isbn | 9783038264767 3038264768 3038350958 9783038350958 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-029192518 |
| oclc_num | 881732878 |
| open_access_boolean | |
| owner | DE-1046 DE-1047 |
| owner_facet | DE-1046 DE-1047 |
| physical | 1 online resource |
| psigel | ZDB-4-EBA ZDB-4-EBA FAW_PDA_EBA |
| publishDate | 2014 |
| publishDateSearch | 2014 |
| publishDateSort | 2014 |
| publisher | Trans Tech Publications |
| record_format | marc |
| series | Applied mechanics and materials |
| series2 | Applied mechanics and materials |
| spelling | International Conference on Applied Mechanics and Manufacturing System 2 2014 Zhengzhou Verfasser (DE-588)1053309597 aut Advanced research on mechanics, manufacturing engineering and applied technology II selected, peer reviewed papers from the 2nd International Conference on Applied Mechanics and Manufacturing System (AMMS 2014), April 26-27, 2014, Zhengzhou, China edited by Helen Zhang, David Jin and X.J. Zhao Durnten-Zurich Trans Tech Publications [2014] © 2014 1 online resource txt rdacontent c rdamedia cr rdacarrier Applied mechanics and materials v. 540 Print version record Advanced Research on Mechanics, Manufacturing Engineering and Applied Technology II; Preface and Committee; Table of Contents; Chapter 1: Materials Science and Processing; The Luminescence Mechanism and the Structure Defects of ZnO Thin Films; Synthesis of Porous Spheres of TiO2 Nanoparticles and its Photocatalysis Behavior for 1-Naphthylamine-4-Azobenzene-4'-Sulfonic Acid; Effects of Substrate Preheating on Microstructure and Interface Characterization of Al2O3-13% TiO2 Ceramic Coating Fabricated by Laser Cladding Preparation and Characterization of Plasma-Sprayed and Laser-Remelted Ni60/Ni-WC Coatings Preparation and Properties of Ag Nanofilms for Organic Solar Cells; Effects of Substrate Temperature on Structure and Optical Property of Cu2O:N Thin Film Deposited by Reactive Pulse Magnetron Sputtering; Research on Chemical Materials with Characteristic on Chemical Looping Combustion of Co-Doped Fe2O3 Oxygen Carrier with CO; Research of Hydrogen Atom Penetration during the Phosphorization Process of High-Strength Steel The Constitutive Model of Solid Ice and Snow with Material Properties Based on the Microscopic Mechanical DeformationExperimental Analysis on Fracture Characteristics and Material Properties of Compacted Ice and Snow; The Test of Aircraft Material with Performance Parameters; Study on Composite Materials Used in the Tennis Racket; The Way of Obtain C4H6O+ Macro Ion by C7H12O+ Excited State; Study on the Preparation of WO3/TiO2 Composite Photocatalyst and its Photocatalytic Activity Research on Refractory Material with Influence of Polyethylene Glycol (PEG) 6000 on the Properties of Lubricant for Slide PlateAnalysis of Micro Inclusions in Q195 Steel; The Research on Three-Dimensional Theoretical Model of Residual Stress on Cutting Surface; Chapter 2: Research and Design in Mechanical Engineering; Study of Lateral Tuyere Layout Impact on the Inner Velocity and Temperature Field of Dry Slag Discharge Machine; Research on the Transmission Characteristics and Mechanical Mechanics of Dual Meshing Points in Involute-Circular Arc Tooth Gear Simulation and Analysis about Different Pressure Angle in Involute Gears Based on Neural NetworkResearch on Involute Gear Undercutting with Mechanical Mechanics Based on Neural Network; The Localization of the Wind Turbine Passive Spindle Brake Based on Mechanical Mechanics; A 3D Computation of Fluid-Structure Interaction in a Cyclone Separator; Performance Analysis of Two Stage Compression Cycle with an Internal Heat Exchanger; The Research on Characteristics of a New Type of Marine Gas Turbine Exhaust Ejector Device; The Design of DC/DC Converter for Battery System in Electric Vehicle Collection of selected, peer reviewed papers from the 2014 2nd International Conference on Applied Mechanics and Manufacturing System (AMMS2014), April 26-27, 2014, Zhengzhou, China. The 125 papers are grouped as follows: Chapter 1: Materials Science and Processing, Chapter 2: Research and Design in Mechanical Engineering, Chapter 3: Construction Technologies and Materials, Chapter 4: Environmental Engineering, Chapter 5: Oil and Mining Engineering and Manufacturing, Chapter 6: Biomechanics, Biomaterials and Biomedicine, Chapter 7: Robotics, Control and Automation, Chapter 8: Applied Informati TECHNOLOGY & ENGINEERING / Mechanical bisacsh Mechanical engineering / Research fast Production engineering / Research fast Mechanical engineering Research Congresses Production engineering Research Congresses (DE-588)1071861417 Konferenzschrift gnd-content Zhang, Helen edt Jin, David edt Zhao, X. J. edt Erscheint auch als Druck-Ausgabe Advanced research on mechanics, manufacturing engineering and applied Applied mechanics and materials 540 (DE-604)BV040665233 540 |
| spellingShingle | Advanced research on mechanics, manufacturing engineering and applied technology II selected, peer reviewed papers from the 2nd International Conference on Applied Mechanics and Manufacturing System (AMMS 2014), April 26-27, 2014, Zhengzhou, China Applied mechanics and materials Advanced Research on Mechanics, Manufacturing Engineering and Applied Technology II; Preface and Committee; Table of Contents; Chapter 1: Materials Science and Processing; The Luminescence Mechanism and the Structure Defects of ZnO Thin Films; Synthesis of Porous Spheres of TiO2 Nanoparticles and its Photocatalysis Behavior for 1-Naphthylamine-4-Azobenzene-4'-Sulfonic Acid; Effects of Substrate Preheating on Microstructure and Interface Characterization of Al2O3-13% TiO2 Ceramic Coating Fabricated by Laser Cladding Preparation and Characterization of Plasma-Sprayed and Laser-Remelted Ni60/Ni-WC Coatings Preparation and Properties of Ag Nanofilms for Organic Solar Cells; Effects of Substrate Temperature on Structure and Optical Property of Cu2O:N Thin Film Deposited by Reactive Pulse Magnetron Sputtering; Research on Chemical Materials with Characteristic on Chemical Looping Combustion of Co-Doped Fe2O3 Oxygen Carrier with CO; Research of Hydrogen Atom Penetration during the Phosphorization Process of High-Strength Steel The Constitutive Model of Solid Ice and Snow with Material Properties Based on the Microscopic Mechanical DeformationExperimental Analysis on Fracture Characteristics and Material Properties of Compacted Ice and Snow; The Test of Aircraft Material with Performance Parameters; Study on Composite Materials Used in the Tennis Racket; The Way of Obtain C4H6O+ Macro Ion by C7H12O+ Excited State; Study on the Preparation of WO3/TiO2 Composite Photocatalyst and its Photocatalytic Activity Research on Refractory Material with Influence of Polyethylene Glycol (PEG) 6000 on the Properties of Lubricant for Slide PlateAnalysis of Micro Inclusions in Q195 Steel; The Research on Three-Dimensional Theoretical Model of Residual Stress on Cutting Surface; Chapter 2: Research and Design in Mechanical Engineering; Study of Lateral Tuyere Layout Impact on the Inner Velocity and Temperature Field of Dry Slag Discharge Machine; Research on the Transmission Characteristics and Mechanical Mechanics of Dual Meshing Points in Involute-Circular Arc Tooth Gear Simulation and Analysis about Different Pressure Angle in Involute Gears Based on Neural NetworkResearch on Involute Gear Undercutting with Mechanical Mechanics Based on Neural Network; The Localization of the Wind Turbine Passive Spindle Brake Based on Mechanical Mechanics; A 3D Computation of Fluid-Structure Interaction in a Cyclone Separator; Performance Analysis of Two Stage Compression Cycle with an Internal Heat Exchanger; The Research on Characteristics of a New Type of Marine Gas Turbine Exhaust Ejector Device; The Design of DC/DC Converter for Battery System in Electric Vehicle Collection of selected, peer reviewed papers from the 2014 2nd International Conference on Applied Mechanics and Manufacturing System (AMMS2014), April 26-27, 2014, Zhengzhou, China. The 125 papers are grouped as follows: Chapter 1: Materials Science and Processing, Chapter 2: Research and Design in Mechanical Engineering, Chapter 3: Construction Technologies and Materials, Chapter 4: Environmental Engineering, Chapter 5: Oil and Mining Engineering and Manufacturing, Chapter 6: Biomechanics, Biomaterials and Biomedicine, Chapter 7: Robotics, Control and Automation, Chapter 8: Applied Informati TECHNOLOGY & ENGINEERING / Mechanical bisacsh Mechanical engineering / Research fast Production engineering / Research fast Mechanical engineering Research Congresses Production engineering Research Congresses |
| subject_GND | (DE-588)1071861417 |
| title | Advanced research on mechanics, manufacturing engineering and applied technology II selected, peer reviewed papers from the 2nd International Conference on Applied Mechanics and Manufacturing System (AMMS 2014), April 26-27, 2014, Zhengzhou, China |
| title_auth | Advanced research on mechanics, manufacturing engineering and applied technology II selected, peer reviewed papers from the 2nd International Conference on Applied Mechanics and Manufacturing System (AMMS 2014), April 26-27, 2014, Zhengzhou, China |
| title_exact_search | Advanced research on mechanics, manufacturing engineering and applied technology II selected, peer reviewed papers from the 2nd International Conference on Applied Mechanics and Manufacturing System (AMMS 2014), April 26-27, 2014, Zhengzhou, China |
| title_full | Advanced research on mechanics, manufacturing engineering and applied technology II selected, peer reviewed papers from the 2nd International Conference on Applied Mechanics and Manufacturing System (AMMS 2014), April 26-27, 2014, Zhengzhou, China edited by Helen Zhang, David Jin and X.J. Zhao |
| title_fullStr | Advanced research on mechanics, manufacturing engineering and applied technology II selected, peer reviewed papers from the 2nd International Conference on Applied Mechanics and Manufacturing System (AMMS 2014), April 26-27, 2014, Zhengzhou, China edited by Helen Zhang, David Jin and X.J. Zhao |
| title_full_unstemmed | Advanced research on mechanics, manufacturing engineering and applied technology II selected, peer reviewed papers from the 2nd International Conference on Applied Mechanics and Manufacturing System (AMMS 2014), April 26-27, 2014, Zhengzhou, China edited by Helen Zhang, David Jin and X.J. Zhao |
| title_short | Advanced research on mechanics, manufacturing engineering and applied technology II |
| title_sort | advanced research on mechanics manufacturing engineering and applied technology ii selected peer reviewed papers from the 2nd international conference on applied mechanics and manufacturing system amms 2014 april 26 27 2014 zhengzhou china |
| title_sub | selected, peer reviewed papers from the 2nd International Conference on Applied Mechanics and Manufacturing System (AMMS 2014), April 26-27, 2014, Zhengzhou, China |
| topic | TECHNOLOGY & ENGINEERING / Mechanical bisacsh Mechanical engineering / Research fast Production engineering / Research fast Mechanical engineering Research Congresses Production engineering Research Congresses |
| topic_facet | TECHNOLOGY & ENGINEERING / Mechanical Mechanical engineering / Research Production engineering / Research Mechanical engineering Research Congresses Production engineering Research Congresses Konferenzschrift |
| volume_link | (DE-604)BV040665233 |
| work_keys_str_mv | AT internationalconferenceonappliedmechanicsandmanufacturingsystemzhengzhou advancedresearchonmechanicsmanufacturingengineeringandappliedtechnologyiiselectedpeerreviewedpapersfromthe2ndinternationalconferenceonappliedmechanicsandmanufacturingsystemamms2014april26272014zhengzhouchina AT zhanghelen advancedresearchonmechanicsmanufacturingengineeringandappliedtechnologyiiselectedpeerreviewedpapersfromthe2ndinternationalconferenceonappliedmechanicsandmanufacturingsystemamms2014april26272014zhengzhouchina AT jindavid advancedresearchonmechanicsmanufacturingengineeringandappliedtechnologyiiselectedpeerreviewedpapersfromthe2ndinternationalconferenceonappliedmechanicsandmanufacturingsystemamms2014april26272014zhengzhouchina AT zhaoxj advancedresearchonmechanicsmanufacturingengineeringandappliedtechnologyiiselectedpeerreviewedpapersfromthe2ndinternationalconferenceonappliedmechanicsandmanufacturingsystemamms2014april26272014zhengzhouchina |