Components, packaging and manufacturing technology II: selected, peer reviewed papers from the 2013 3rd International Conference on Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia
Gespeichert in:
| Körperschaft: | |
|---|---|
| Weitere Verfasser: | |
| Format: | Elektronisch E-Book |
| Sprache: | English |
| Veröffentlicht: |
[Zurich], Switzerland
Trans Tech Publications
[2014]
|
| Schriftenreihe: | Applied mechanics and materials
509 |
| Schlagworte: | |
| Online-Zugang: | FAW01 FAW02 |
| Beschreibung: | Online resource; title from PDF title page (ebrary, viewed March 21, 2014) |
| Beschreibung: | 1 online resource (245 pages) illustrations |
| ISBN: | 9783038263944 303826394X 9783038350132 |
Internformat
MARC
| LEADER | 00000nmm a2200000zcb4500 | ||
|---|---|---|---|
| 001 | BV043780918 | ||
| 003 | DE-604 | ||
| 005 | 20180205 | ||
| 006 | a |||| 10||| | ||
| 007 | cr|uuu---uuuuu | ||
| 008 | 160920s2014 |||| o||u| ||||||eng d | ||
| 020 | |a 9783038263944 |9 978-3-03826-394-4 | ||
| 020 | |a 303826394X |9 3-03826-394-X | ||
| 020 | |a 9783038350132 |9 978-3-03835-013-2 | ||
| 035 | |a (ZDB-4-EBA)ocn878139687 | ||
| 035 | |a (OCoLC)878139687 | ||
| 035 | |a (DE-599)BVBBV043780918 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-1046 |a DE-1047 | ||
| 082 | 0 | |a 621.381 |2 23 | |
| 110 | 2 | |a International Conference on Packaging and Manufacturing Technology < 2013, Brisbane Australia> |e Verfasser |4 aut | |
| 245 | 1 | 0 | |a Components, packaging and manufacturing technology II |b selected, peer reviewed papers from the 2013 3rd International Conference on Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia |c edited by Andy Wu |
| 264 | 1 | |a [Zurich], Switzerland |b Trans Tech Publications |c [2014] | |
| 264 | 4 | |c © 2014 | |
| 300 | |a 1 online resource (245 pages) |b illustrations | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b c |2 rdamedia | ||
| 338 | |b cr |2 rdacarrier | ||
| 490 | 1 | |a Applied mechanics and materials |v v. 509 | |
| 500 | |a Online resource; title from PDF title page (ebrary, viewed March 21, 2014) | ||
| 505 | 8 | |a Components, Packaging and Manufacturing Technology II; Preface and Organizing Committee; Table of Contents; Chapter 1: Materials Science and Materials Processing Technology; Precise Determination of Band Gap Naturally via Absorption/Reflectance/Transmission Spectra; Preparation and Rheological Characterization of Cross-Linked Dialdehyde Carboxymethyl Cellulose; The Curing Behavior of Organosilicone Materials for Large-Power LED Packaging; The Status and Development of ECAP; Chapter 2: Mechanics; Dynamic Torsional Response of a Pile Partially Embedded in Saturated Soil | |
| 505 | 8 | |a Research on Internal Flow Field Simulation of Hydropower Station Pressure Steel Pipe Based on FLUENTA Discrimination Method of Saturated Sand Liquefaction Possibility Based on Support Vector Machine; Dragon Boat Straight Road Racing Rowing Technique Mechanical Movement Analysis; Dragon Boat Technology on the Influence of Fluid Mechanics Research; Vortex Stability Analysis Based on Coupling the Rubbing with BTA Boring Bar; Development and Application on Ultrahigh Speed Grinding Processing Technology; Chapter 3: Modelling, Design and Manufacturing | |
| 505 | 8 | |a Multi-Objective Optimization of Vehicle Air Suspension Based on Simulink-Mfile Mixed ProgrammingImpacts of Solder Voids on Power Devices' Thermal Characteristics; Research on Five-Axis NC Machining Simulation for Four-Blade Propeller Based on UG & VERICUT; Investigation on Aerodynamic Configuration of Monitoring Long Endurance UAV; Passenger Vehicle Clutch Reliability Optimization Based on the Stress-Strength Interference Model; Modularization Technology Development Prospects; Design and Manufacture of a Forehand Attack Exercising Device for Teaching and Training of Table Tennis | |
| 505 | 8 | |a Development and Manufacture on the New Yoga Exercising DeviceResearch on Compensation Correction of Leak Impact Factor of Kent Index Method; Application of MATLAB in Mechanical Optimal Design; Analysis of Performance of Automotive Exhaust Muffler Based on ANSYS Finite Element; Theoretical Research on a New Type Tube-in-Tube Evaporative Condenser; Study on 3D Modeling and Flow Field Simulation of Urea-SCR Catalytic Converter; Numerical Simulation for Perforation-Caused Leakage Diffusion of Buried Gas Pipeline | |
| 505 | 8 | |a Numerical Study on Heat Exchange Characteristics of Runways with Snow-Melting System Using Geothermal SourcesResearch of the Assembly Model Based on Parts Attribute Semantic; Chapter 4: Automation, Control, Information Technology and MEMS; Slant-Face Fiber Side Coupling of Vertical Cavity Surface Emitting Laser; The Relationships of Prior Information and Interval Partition on the Forecasting Effect of Fuzzy Time Series Two-Factor Model; Research on the Behavior of Intelligent Role in Computer Games Based on Behavior Tree; Building the Audit Information System in Cloud Computing Environment | |
| 505 | 8 | |a Collection of selected, peer reviewed papers from the 2013 3rd International Conference on Components, Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia. The 42 papers are grouped as follows: Chapter 1: Materials Science and Materials Processing Technology; Chapter 2: Mechanics; Chapter 3: Modelling, Design and Manufacturing; Chapter 4: Automation, Control, Information Technology and MEMS. | |
| 650 | 7 | |a TECHNOLOGY & ENGINEERING / Mechanical |2 bisacsh | |
| 650 | 7 | |a Electronic apparatus and appliances |2 fast | |
| 650 | 7 | |a Electronic packaging |2 fast | |
| 650 | 7 | |a Manufacturing processes |2 fast | |
| 650 | 7 | |a Microelectronic packaging |2 fast | |
| 650 | 4 | |a Electronic apparatus and appliances |v Congresses |a Electronic packaging |v Congresses |a Microelectronic packaging |v Congresses |a Manufacturing processes |v Congresses | |
| 655 | 7 | |0 (DE-588)1071861417 |a Konferenzschrift |2 gnd-content | |
| 700 | 1 | |a Wu, Andy |4 edt | |
| 776 | 0 | 8 | |i Erscheint auch als |n Druck-Ausgabe |a Components, packaging and manufacturing technology II : selected, peer reviewed papers from the 2013 3rd International Conference on Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia |
| 830 | 0 | |a Applied mechanics and materials |v 509 |w (DE-604)BV040665233 |9 509 | |
| 912 | |a ZDB-4-EBA | ||
| 999 | |a oai:aleph.bib-bvb.de:BVB01-029191978 | ||
| 966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711958 |l FAW01 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext | |
| 966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711958 |l FAW02 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext | |
Datensatz im Suchindex
| _version_ | 1804176611065462784 |
|---|---|
| any_adam_object | |
| author2 | Wu, Andy |
| author2_role | edt |
| author2_variant | a w aw |
| author_corporate | International Conference on Packaging and Manufacturing Technology < 2013, Brisbane Australia> |
| author_corporate_role | aut |
| author_facet | Wu, Andy International Conference on Packaging and Manufacturing Technology < 2013, Brisbane Australia> |
| author_sort | International Conference on Packaging and Manufacturing Technology < 2013, Brisbane Australia> |
| building | Verbundindex |
| bvnumber | BV043780918 |
| collection | ZDB-4-EBA |
| contents | Components, Packaging and Manufacturing Technology II; Preface and Organizing Committee; Table of Contents; Chapter 1: Materials Science and Materials Processing Technology; Precise Determination of Band Gap Naturally via Absorption/Reflectance/Transmission Spectra; Preparation and Rheological Characterization of Cross-Linked Dialdehyde Carboxymethyl Cellulose; The Curing Behavior of Organosilicone Materials for Large-Power LED Packaging; The Status and Development of ECAP; Chapter 2: Mechanics; Dynamic Torsional Response of a Pile Partially Embedded in Saturated Soil Research on Internal Flow Field Simulation of Hydropower Station Pressure Steel Pipe Based on FLUENTA Discrimination Method of Saturated Sand Liquefaction Possibility Based on Support Vector Machine; Dragon Boat Straight Road Racing Rowing Technique Mechanical Movement Analysis; Dragon Boat Technology on the Influence of Fluid Mechanics Research; Vortex Stability Analysis Based on Coupling the Rubbing with BTA Boring Bar; Development and Application on Ultrahigh Speed Grinding Processing Technology; Chapter 3: Modelling, Design and Manufacturing Multi-Objective Optimization of Vehicle Air Suspension Based on Simulink-Mfile Mixed ProgrammingImpacts of Solder Voids on Power Devices' Thermal Characteristics; Research on Five-Axis NC Machining Simulation for Four-Blade Propeller Based on UG & VERICUT; Investigation on Aerodynamic Configuration of Monitoring Long Endurance UAV; Passenger Vehicle Clutch Reliability Optimization Based on the Stress-Strength Interference Model; Modularization Technology Development Prospects; Design and Manufacture of a Forehand Attack Exercising Device for Teaching and Training of Table Tennis Development and Manufacture on the New Yoga Exercising DeviceResearch on Compensation Correction of Leak Impact Factor of Kent Index Method; Application of MATLAB in Mechanical Optimal Design; Analysis of Performance of Automotive Exhaust Muffler Based on ANSYS Finite Element; Theoretical Research on a New Type Tube-in-Tube Evaporative Condenser; Study on 3D Modeling and Flow Field Simulation of Urea-SCR Catalytic Converter; Numerical Simulation for Perforation-Caused Leakage Diffusion of Buried Gas Pipeline Numerical Study on Heat Exchange Characteristics of Runways with Snow-Melting System Using Geothermal SourcesResearch of the Assembly Model Based on Parts Attribute Semantic; Chapter 4: Automation, Control, Information Technology and MEMS; Slant-Face Fiber Side Coupling of Vertical Cavity Surface Emitting Laser; The Relationships of Prior Information and Interval Partition on the Forecasting Effect of Fuzzy Time Series Two-Factor Model; Research on the Behavior of Intelligent Role in Computer Games Based on Behavior Tree; Building the Audit Information System in Cloud Computing Environment Collection of selected, peer reviewed papers from the 2013 3rd International Conference on Components, Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia. The 42 papers are grouped as follows: Chapter 1: Materials Science and Materials Processing Technology; Chapter 2: Mechanics; Chapter 3: Modelling, Design and Manufacturing; Chapter 4: Automation, Control, Information Technology and MEMS. |
| ctrlnum | (ZDB-4-EBA)ocn878139687 (OCoLC)878139687 (DE-599)BVBBV043780918 |
| dewey-full | 621.381 |
| dewey-hundreds | 600 - Technology (Applied sciences) |
| dewey-ones | 621 - Applied physics |
| dewey-raw | 621.381 |
| dewey-search | 621.381 |
| dewey-sort | 3621.381 |
| dewey-tens | 620 - Engineering and allied operations |
| discipline | Elektrotechnik / Elektronik / Nachrichtentechnik |
| format | Electronic eBook |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>06027nmm a2200577zcb4500</leader><controlfield tag="001">BV043780918</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20180205 </controlfield><controlfield tag="006">a |||| 10||| </controlfield><controlfield tag="007">cr|uuu---uuuuu</controlfield><controlfield tag="008">160920s2014 |||| o||u| ||||||eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038263944</subfield><subfield code="9">978-3-03826-394-4</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">303826394X</subfield><subfield code="9">3-03826-394-X</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038350132</subfield><subfield code="9">978-3-03835-013-2</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ZDB-4-EBA)ocn878139687</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)878139687</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV043780918</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-1046</subfield><subfield code="a">DE-1047</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">621.381</subfield><subfield code="2">23</subfield></datafield><datafield tag="110" ind1="2" ind2=" "><subfield code="a">International Conference on Packaging and Manufacturing Technology < 2013, Brisbane Australia></subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Components, packaging and manufacturing technology II</subfield><subfield code="b">selected, peer reviewed papers from the 2013 3rd International Conference on Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia</subfield><subfield code="c">edited by Andy Wu</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">[Zurich], Switzerland</subfield><subfield code="b">Trans Tech Publications</subfield><subfield code="c">[2014]</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">© 2014</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (245 pages)</subfield><subfield code="b">illustrations</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Applied mechanics and materials</subfield><subfield code="v">v. 509</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Online resource; title from PDF title page (ebrary, viewed March 21, 2014)</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Components, Packaging and Manufacturing Technology II; Preface and Organizing Committee; Table of Contents; Chapter 1: Materials Science and Materials Processing Technology; Precise Determination of Band Gap Naturally via Absorption/Reflectance/Transmission Spectra; Preparation and Rheological Characterization of Cross-Linked Dialdehyde Carboxymethyl Cellulose; The Curing Behavior of Organosilicone Materials for Large-Power LED Packaging; The Status and Development of ECAP; Chapter 2: Mechanics; Dynamic Torsional Response of a Pile Partially Embedded in Saturated Soil</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Research on Internal Flow Field Simulation of Hydropower Station Pressure Steel Pipe Based on FLUENTA Discrimination Method of Saturated Sand Liquefaction Possibility Based on Support Vector Machine; Dragon Boat Straight Road Racing Rowing Technique Mechanical Movement Analysis; Dragon Boat Technology on the Influence of Fluid Mechanics Research; Vortex Stability Analysis Based on Coupling the Rubbing with BTA Boring Bar; Development and Application on Ultrahigh Speed Grinding Processing Technology; Chapter 3: Modelling, Design and Manufacturing</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Multi-Objective Optimization of Vehicle Air Suspension Based on Simulink-Mfile Mixed ProgrammingImpacts of Solder Voids on Power Devices' Thermal Characteristics; Research on Five-Axis NC Machining Simulation for Four-Blade Propeller Based on UG & VERICUT; Investigation on Aerodynamic Configuration of Monitoring Long Endurance UAV; Passenger Vehicle Clutch Reliability Optimization Based on the Stress-Strength Interference Model; Modularization Technology Development Prospects; Design and Manufacture of a Forehand Attack Exercising Device for Teaching and Training of Table Tennis</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Development and Manufacture on the New Yoga Exercising DeviceResearch on Compensation Correction of Leak Impact Factor of Kent Index Method; Application of MATLAB in Mechanical Optimal Design; Analysis of Performance of Automotive Exhaust Muffler Based on ANSYS Finite Element; Theoretical Research on a New Type Tube-in-Tube Evaporative Condenser; Study on 3D Modeling and Flow Field Simulation of Urea-SCR Catalytic Converter; Numerical Simulation for Perforation-Caused Leakage Diffusion of Buried Gas Pipeline</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Numerical Study on Heat Exchange Characteristics of Runways with Snow-Melting System Using Geothermal SourcesResearch of the Assembly Model Based on Parts Attribute Semantic; Chapter 4: Automation, Control, Information Technology and MEMS; Slant-Face Fiber Side Coupling of Vertical Cavity Surface Emitting Laser; The Relationships of Prior Information and Interval Partition on the Forecasting Effect of Fuzzy Time Series Two-Factor Model; Research on the Behavior of Intelligent Role in Computer Games Based on Behavior Tree; Building the Audit Information System in Cloud Computing Environment</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Collection of selected, peer reviewed papers from the 2013 3rd International Conference on Components, Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia. The 42 papers are grouped as follows: Chapter 1: Materials Science and Materials Processing Technology; Chapter 2: Mechanics; Chapter 3: Modelling, Design and Manufacturing; Chapter 4: Automation, Control, Information Technology and MEMS.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING / Mechanical</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Electronic apparatus and appliances</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Electronic packaging</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Manufacturing processes</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Microelectronic packaging</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Electronic apparatus and appliances</subfield><subfield code="v">Congresses</subfield><subfield code="a">Electronic packaging</subfield><subfield code="v">Congresses</subfield><subfield code="a">Microelectronic packaging</subfield><subfield code="v">Congresses</subfield><subfield code="a">Manufacturing processes</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)1071861417</subfield><subfield code="a">Konferenzschrift</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Wu, Andy</subfield><subfield code="4">edt</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Druck-Ausgabe</subfield><subfield code="a">Components, packaging and manufacturing technology II : selected, peer reviewed papers from the 2013 3rd International Conference on Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Applied mechanics and materials</subfield><subfield code="v">509</subfield><subfield code="w">(DE-604)BV040665233</subfield><subfield code="9">509</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-029191978</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711958</subfield><subfield code="l">FAW01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711958</subfield><subfield code="l">FAW02</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield></record></collection> |
| genre | (DE-588)1071861417 Konferenzschrift gnd-content |
| genre_facet | Konferenzschrift |
| id | DE-604.BV043780918 |
| illustrated | Illustrated |
| indexdate | 2024-07-10T07:34:56Z |
| institution | BVB |
| isbn | 9783038263944 303826394X 9783038350132 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-029191978 |
| oclc_num | 878139687 |
| open_access_boolean | |
| owner | DE-1046 DE-1047 |
| owner_facet | DE-1046 DE-1047 |
| physical | 1 online resource (245 pages) illustrations |
| psigel | ZDB-4-EBA ZDB-4-EBA FAW_PDA_EBA |
| publishDate | 2014 |
| publishDateSearch | 2014 |
| publishDateSort | 2014 |
| publisher | Trans Tech Publications |
| record_format | marc |
| series | Applied mechanics and materials |
| series2 | Applied mechanics and materials |
| spelling | International Conference on Packaging and Manufacturing Technology < 2013, Brisbane Australia> Verfasser aut Components, packaging and manufacturing technology II selected, peer reviewed papers from the 2013 3rd International Conference on Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia edited by Andy Wu [Zurich], Switzerland Trans Tech Publications [2014] © 2014 1 online resource (245 pages) illustrations txt rdacontent c rdamedia cr rdacarrier Applied mechanics and materials v. 509 Online resource; title from PDF title page (ebrary, viewed March 21, 2014) Components, Packaging and Manufacturing Technology II; Preface and Organizing Committee; Table of Contents; Chapter 1: Materials Science and Materials Processing Technology; Precise Determination of Band Gap Naturally via Absorption/Reflectance/Transmission Spectra; Preparation and Rheological Characterization of Cross-Linked Dialdehyde Carboxymethyl Cellulose; The Curing Behavior of Organosilicone Materials for Large-Power LED Packaging; The Status and Development of ECAP; Chapter 2: Mechanics; Dynamic Torsional Response of a Pile Partially Embedded in Saturated Soil Research on Internal Flow Field Simulation of Hydropower Station Pressure Steel Pipe Based on FLUENTA Discrimination Method of Saturated Sand Liquefaction Possibility Based on Support Vector Machine; Dragon Boat Straight Road Racing Rowing Technique Mechanical Movement Analysis; Dragon Boat Technology on the Influence of Fluid Mechanics Research; Vortex Stability Analysis Based on Coupling the Rubbing with BTA Boring Bar; Development and Application on Ultrahigh Speed Grinding Processing Technology; Chapter 3: Modelling, Design and Manufacturing Multi-Objective Optimization of Vehicle Air Suspension Based on Simulink-Mfile Mixed ProgrammingImpacts of Solder Voids on Power Devices' Thermal Characteristics; Research on Five-Axis NC Machining Simulation for Four-Blade Propeller Based on UG & VERICUT; Investigation on Aerodynamic Configuration of Monitoring Long Endurance UAV; Passenger Vehicle Clutch Reliability Optimization Based on the Stress-Strength Interference Model; Modularization Technology Development Prospects; Design and Manufacture of a Forehand Attack Exercising Device for Teaching and Training of Table Tennis Development and Manufacture on the New Yoga Exercising DeviceResearch on Compensation Correction of Leak Impact Factor of Kent Index Method; Application of MATLAB in Mechanical Optimal Design; Analysis of Performance of Automotive Exhaust Muffler Based on ANSYS Finite Element; Theoretical Research on a New Type Tube-in-Tube Evaporative Condenser; Study on 3D Modeling and Flow Field Simulation of Urea-SCR Catalytic Converter; Numerical Simulation for Perforation-Caused Leakage Diffusion of Buried Gas Pipeline Numerical Study on Heat Exchange Characteristics of Runways with Snow-Melting System Using Geothermal SourcesResearch of the Assembly Model Based on Parts Attribute Semantic; Chapter 4: Automation, Control, Information Technology and MEMS; Slant-Face Fiber Side Coupling of Vertical Cavity Surface Emitting Laser; The Relationships of Prior Information and Interval Partition on the Forecasting Effect of Fuzzy Time Series Two-Factor Model; Research on the Behavior of Intelligent Role in Computer Games Based on Behavior Tree; Building the Audit Information System in Cloud Computing Environment Collection of selected, peer reviewed papers from the 2013 3rd International Conference on Components, Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia. The 42 papers are grouped as follows: Chapter 1: Materials Science and Materials Processing Technology; Chapter 2: Mechanics; Chapter 3: Modelling, Design and Manufacturing; Chapter 4: Automation, Control, Information Technology and MEMS. TECHNOLOGY & ENGINEERING / Mechanical bisacsh Electronic apparatus and appliances fast Electronic packaging fast Manufacturing processes fast Microelectronic packaging fast Electronic apparatus and appliances Congresses Electronic packaging Congresses Microelectronic packaging Congresses Manufacturing processes Congresses (DE-588)1071861417 Konferenzschrift gnd-content Wu, Andy edt Erscheint auch als Druck-Ausgabe Components, packaging and manufacturing technology II : selected, peer reviewed papers from the 2013 3rd International Conference on Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia Applied mechanics and materials 509 (DE-604)BV040665233 509 |
| spellingShingle | Components, packaging and manufacturing technology II selected, peer reviewed papers from the 2013 3rd International Conference on Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia Applied mechanics and materials Components, Packaging and Manufacturing Technology II; Preface and Organizing Committee; Table of Contents; Chapter 1: Materials Science and Materials Processing Technology; Precise Determination of Band Gap Naturally via Absorption/Reflectance/Transmission Spectra; Preparation and Rheological Characterization of Cross-Linked Dialdehyde Carboxymethyl Cellulose; The Curing Behavior of Organosilicone Materials for Large-Power LED Packaging; The Status and Development of ECAP; Chapter 2: Mechanics; Dynamic Torsional Response of a Pile Partially Embedded in Saturated Soil Research on Internal Flow Field Simulation of Hydropower Station Pressure Steel Pipe Based on FLUENTA Discrimination Method of Saturated Sand Liquefaction Possibility Based on Support Vector Machine; Dragon Boat Straight Road Racing Rowing Technique Mechanical Movement Analysis; Dragon Boat Technology on the Influence of Fluid Mechanics Research; Vortex Stability Analysis Based on Coupling the Rubbing with BTA Boring Bar; Development and Application on Ultrahigh Speed Grinding Processing Technology; Chapter 3: Modelling, Design and Manufacturing Multi-Objective Optimization of Vehicle Air Suspension Based on Simulink-Mfile Mixed ProgrammingImpacts of Solder Voids on Power Devices' Thermal Characteristics; Research on Five-Axis NC Machining Simulation for Four-Blade Propeller Based on UG & VERICUT; Investigation on Aerodynamic Configuration of Monitoring Long Endurance UAV; Passenger Vehicle Clutch Reliability Optimization Based on the Stress-Strength Interference Model; Modularization Technology Development Prospects; Design and Manufacture of a Forehand Attack Exercising Device for Teaching and Training of Table Tennis Development and Manufacture on the New Yoga Exercising DeviceResearch on Compensation Correction of Leak Impact Factor of Kent Index Method; Application of MATLAB in Mechanical Optimal Design; Analysis of Performance of Automotive Exhaust Muffler Based on ANSYS Finite Element; Theoretical Research on a New Type Tube-in-Tube Evaporative Condenser; Study on 3D Modeling and Flow Field Simulation of Urea-SCR Catalytic Converter; Numerical Simulation for Perforation-Caused Leakage Diffusion of Buried Gas Pipeline Numerical Study on Heat Exchange Characteristics of Runways with Snow-Melting System Using Geothermal SourcesResearch of the Assembly Model Based on Parts Attribute Semantic; Chapter 4: Automation, Control, Information Technology and MEMS; Slant-Face Fiber Side Coupling of Vertical Cavity Surface Emitting Laser; The Relationships of Prior Information and Interval Partition on the Forecasting Effect of Fuzzy Time Series Two-Factor Model; Research on the Behavior of Intelligent Role in Computer Games Based on Behavior Tree; Building the Audit Information System in Cloud Computing Environment Collection of selected, peer reviewed papers from the 2013 3rd International Conference on Components, Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia. The 42 papers are grouped as follows: Chapter 1: Materials Science and Materials Processing Technology; Chapter 2: Mechanics; Chapter 3: Modelling, Design and Manufacturing; Chapter 4: Automation, Control, Information Technology and MEMS. TECHNOLOGY & ENGINEERING / Mechanical bisacsh Electronic apparatus and appliances fast Electronic packaging fast Manufacturing processes fast Microelectronic packaging fast Electronic apparatus and appliances Congresses Electronic packaging Congresses Microelectronic packaging Congresses Manufacturing processes Congresses |
| subject_GND | (DE-588)1071861417 |
| title | Components, packaging and manufacturing technology II selected, peer reviewed papers from the 2013 3rd International Conference on Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia |
| title_auth | Components, packaging and manufacturing technology II selected, peer reviewed papers from the 2013 3rd International Conference on Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia |
| title_exact_search | Components, packaging and manufacturing technology II selected, peer reviewed papers from the 2013 3rd International Conference on Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia |
| title_full | Components, packaging and manufacturing technology II selected, peer reviewed papers from the 2013 3rd International Conference on Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia edited by Andy Wu |
| title_fullStr | Components, packaging and manufacturing technology II selected, peer reviewed papers from the 2013 3rd International Conference on Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia edited by Andy Wu |
| title_full_unstemmed | Components, packaging and manufacturing technology II selected, peer reviewed papers from the 2013 3rd International Conference on Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia edited by Andy Wu |
| title_short | Components, packaging and manufacturing technology II |
| title_sort | components packaging and manufacturing technology ii selected peer reviewed papers from the 2013 3rd international conference on packaging and manufacturing technology iccpmt 2013 december 31 2013 january 2 2014 brisbane australia |
| title_sub | selected, peer reviewed papers from the 2013 3rd International Conference on Packaging and Manufacturing Technology (ICCPMT 2013), December 31, 2013 - January 2, 2014, Brisbane Australia |
| topic | TECHNOLOGY & ENGINEERING / Mechanical bisacsh Electronic apparatus and appliances fast Electronic packaging fast Manufacturing processes fast Microelectronic packaging fast Electronic apparatus and appliances Congresses Electronic packaging Congresses Microelectronic packaging Congresses Manufacturing processes Congresses |
| topic_facet | TECHNOLOGY & ENGINEERING / Mechanical Electronic apparatus and appliances Electronic packaging Manufacturing processes Microelectronic packaging Electronic apparatus and appliances Congresses Electronic packaging Congresses Microelectronic packaging Congresses Manufacturing processes Congresses Konferenzschrift |
| volume_link | (DE-604)BV040665233 |
| work_keys_str_mv | AT internationalconferenceonpackagingandmanufacturingtechnology2013brisbaneaustralia componentspackagingandmanufacturingtechnologyiiselectedpeerreviewedpapersfromthe20133rdinternationalconferenceonpackagingandmanufacturingtechnologyiccpmt2013december312013january22014brisbaneaustralia AT wuandy componentspackagingandmanufacturingtechnologyiiselectedpeerreviewedpapersfromthe20133rdinternationalconferenceonpackagingandmanufacturingtechnologyiccpmt2013december312013january22014brisbaneaustralia |