Advanced materials science and technology: selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia
Gespeichert in:
| Körperschaft: | |
|---|---|
| Weitere Verfasser: | |
| Format: | Elektronisch E-Book |
| Sprache: | English |
| Veröffentlicht: |
Zurich, Switzerland
Trans Tech Publications
[2014]
|
| Schriftenreihe: | Advanced materials research
v. 896 |
| Schlagworte: | |
| Online-Zugang: | FAW01 FAW02 |
| Beschreibung: | Online resource; title from PDF title page (ebrary, viewed March 20, 2014) |
| Beschreibung: | 1 online resource (744 pages) illustrations (some color), graphs, photographs |
| ISBN: | 9783038264125 3038264121 9783038350316 |
Internformat
MARC
| LEADER | 00000nmm a2200000zcb4500 | ||
|---|---|---|---|
| 001 | BV043780908 | ||
| 003 | DE-604 | ||
| 005 | 00000000000000.0 | ||
| 007 | cr|uuu---uuuuu | ||
| 008 | 160920s2014 |||| o||u| ||||||eng d | ||
| 020 | |a 9783038264125 |9 978-3-03826-412-5 | ||
| 020 | |a 3038264121 |9 3-03826-412-1 | ||
| 020 | |a 9783038350316 |9 978-3-03835-031-6 | ||
| 035 | |a (ZDB-4-EBA)ocn878138258 | ||
| 035 | |a (OCoLC)878138258 | ||
| 035 | |a (DE-599)BVBBV043780908 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-1046 |a DE-1047 | ||
| 082 | 0 | |a 620.11 |2 23 | |
| 110 | 2 | |a International Conference on Advanced Materials Science and Technology <2013, Yogyakarta, Indonesia> |e Verfasser |4 aut | |
| 245 | 1 | 0 | |a Advanced materials science and technology |b selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia |c edited by Kuwat Triyana [and four others] |
| 264 | 1 | |a Zurich, Switzerland |b Trans Tech Publications |c [2014] | |
| 264 | 4 | |c © 2014 | |
| 300 | |a 1 online resource (744 pages) |b illustrations (some color), graphs, photographs | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b c |2 rdamedia | ||
| 338 | |b cr |2 rdacarrier | ||
| 490 | 0 | |a Advanced materials research |v v. 896 | |
| 500 | |a Online resource; title from PDF title page (ebrary, viewed March 20, 2014) | ||
| 505 | 8 | |a Advanced Materials Science and Technology; Preface and Conference Organizers; Table of Contents; Chapter 1: Nanofibers and Membranes; The Role and Prospect of Nanomaterials in Polymeric Membrane for Water and Wastewater Treatment: A State-of-the-Art Overview; Synthesis of Low Fouling Porous Polymeric Membranes; Mass Production of Stacked Styrofoam Nanofibers Using a Multinozzle and Drum Collector Electrospinning System; Transparent and Conductive Fluorinated-Tin Oxide Prepared by Atmospheric Deposition Technique; Gas Sensing Using Static and Dynamic Modes Piezoresistive Microcantilever | |
| 505 | 8 | |a One-Step Fabrication of Short Nanofibers by Electrospinning: Effect of Needle Size on Nanofiber LengthCarbon Dioxide Permeation Characteristics in Asymmetric Polysulfone Hollow Fiber Membrane: Effect of Constant Heating and Progressive Heating; Electrospinning of Poly(vinyl alcohol)/Chitosan via Multi-Nozzle Spinneret and Drum Collector; A Simple Way of Producing Nano Anatase TiO2 in Polyvinyl Alcohol Fibers; The Crystal Structure, Conductivity Character and Ionic Migration of Samarium Doped-Ceria (SDC) and its Composite with Sodium Carbonate | |
| 505 | 8 | |a Preparation of Sulfonate Grafted Silica/Chitosan-Based Proton Exchange MembraneSynthesis and Characterization of Solid Polymer Electrolyte from N-Succinyl Chitosan and Lithium Perchlorate; Epoxidised Natural Rubber Based Polymer Electrolyte Systems for Electrochemical Device Applications; Eggs Shell Membrane as Natural Separator for Supercapacitor Applications; Titania Coated Ceramic Membrane from Clay and Muntilan Sand for Wastewater Filter Application; Utilization of Fly Ash as Ceramic Support Mixture for the Synthesis of Zeolite Pervaporation Membrane | |
| 505 | 8 | |a Synthesis and Characterization of Nanostructured Tungsten Oxide by Hard Template MethodChapter 2: Nanoparticles and Powders; Excited-State Proton Transfer in Fluorescent Photoactive Yellow Protein Containing 7-Hydroxycoumarin; Effect of Heating Time on Atrazine-Based MIP Materials Synthesized via the Cooling-Heating Method; Preparation of Orange Peel Based Activated Carbons as Cathodes in Lithium Ion Capacitors; Synthesis of Fe2O3/C Nanocomposite Using Microwave Assisted Calcination Method; Magnetic CuFe2O4 Nanoparticles for Adsorpstion of Cr(VI) from Aqueous Solution | |
| 505 | 8 | |a Optical Properties of Zn-Doped CeO2 Nanoparticles as a Function of Zn ContentChelating Agent Role in Synthesizing Cerate-Zirconate Powder by a Sol-Gel Method; Influence of Ionic Surfactants under Ultrasonic Irradiation to Reduce the Particle Size of Mechanically Alloyed La1-XSrX Fe0.5Mn0.25Ti0.25O3 Powders; Covalent Functionalization of Amino Group onto Carbon-Based Magnetic Nanoparticles Using Pulsed-Powder Explosion Technique; Magnetic Properties and Microstructures of Polyethylene Glycol (PEG)-Coated Cobalt Ferrite (CoFe2O4) Nanoparticles Synthesized by Coprecipitation Method | |
| 505 | 8 | |a Collection of selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia. The 157 papers are grouped as follows: Chapter 1: Nanofibers and Membranes, Chapter 2: Nanoparticles and Powders, Chapter 3: Thick and Thin Films, Chapter 4: Biomaterials, Chapter 5: Electronic Materials, Chapter 6: Magnetic Materials, Chapter 7: Optical Materials, Chapter 8: Composites, Ceramics, and Alloys, Chapter 9: Measurement and Characterization Techniques. The proceedings of the September 2013 confe | |
| 650 | 7 | |a TECHNOLOGY & ENGINEERING / Engineering (General) |2 bisacsh | |
| 650 | 7 | |a TECHNOLOGY & ENGINEERING / Reference |2 bisacsh | |
| 650 | 7 | |a Materials science |2 fast | |
| 650 | 7 | |a Technology |2 fast | |
| 650 | 4 | |a Materials science |v Congresses |a Technology |v Congresses | |
| 655 | 7 | |0 (DE-588)1071861417 |a Konferenzschrift |2 gnd-content | |
| 700 | 1 | |a Triyana, Kuwat |4 edt | |
| 776 | 0 | 8 | |i Erscheint auch als |n Druck-Ausgabe |a Advanced materials science and technology : selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia |
| 912 | |a ZDB-4-EBA | ||
| 999 | |a oai:aleph.bib-bvb.de:BVB01-029191968 | ||
| 966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711973 |l FAW01 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext | |
| 966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711973 |l FAW02 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext | |
Datensatz im Suchindex
| _version_ | 1804176611046588416 |
|---|---|
| any_adam_object | |
| author2 | Triyana, Kuwat |
| author2_role | edt |
| author2_variant | k t kt |
| author_corporate | International Conference on Advanced Materials Science and Technology <2013, Yogyakarta, Indonesia> |
| author_corporate_role | aut |
| author_facet | Triyana, Kuwat International Conference on Advanced Materials Science and Technology <2013, Yogyakarta, Indonesia> |
| author_sort | International Conference on Advanced Materials Science and Technology <2013, Yogyakarta, Indonesia> |
| building | Verbundindex |
| bvnumber | BV043780908 |
| collection | ZDB-4-EBA |
| contents | Advanced Materials Science and Technology; Preface and Conference Organizers; Table of Contents; Chapter 1: Nanofibers and Membranes; The Role and Prospect of Nanomaterials in Polymeric Membrane for Water and Wastewater Treatment: A State-of-the-Art Overview; Synthesis of Low Fouling Porous Polymeric Membranes; Mass Production of Stacked Styrofoam Nanofibers Using a Multinozzle and Drum Collector Electrospinning System; Transparent and Conductive Fluorinated-Tin Oxide Prepared by Atmospheric Deposition Technique; Gas Sensing Using Static and Dynamic Modes Piezoresistive Microcantilever One-Step Fabrication of Short Nanofibers by Electrospinning: Effect of Needle Size on Nanofiber LengthCarbon Dioxide Permeation Characteristics in Asymmetric Polysulfone Hollow Fiber Membrane: Effect of Constant Heating and Progressive Heating; Electrospinning of Poly(vinyl alcohol)/Chitosan via Multi-Nozzle Spinneret and Drum Collector; A Simple Way of Producing Nano Anatase TiO2 in Polyvinyl Alcohol Fibers; The Crystal Structure, Conductivity Character and Ionic Migration of Samarium Doped-Ceria (SDC) and its Composite with Sodium Carbonate Preparation of Sulfonate Grafted Silica/Chitosan-Based Proton Exchange MembraneSynthesis and Characterization of Solid Polymer Electrolyte from N-Succinyl Chitosan and Lithium Perchlorate; Epoxidised Natural Rubber Based Polymer Electrolyte Systems for Electrochemical Device Applications; Eggs Shell Membrane as Natural Separator for Supercapacitor Applications; Titania Coated Ceramic Membrane from Clay and Muntilan Sand for Wastewater Filter Application; Utilization of Fly Ash as Ceramic Support Mixture for the Synthesis of Zeolite Pervaporation Membrane Synthesis and Characterization of Nanostructured Tungsten Oxide by Hard Template MethodChapter 2: Nanoparticles and Powders; Excited-State Proton Transfer in Fluorescent Photoactive Yellow Protein Containing 7-Hydroxycoumarin; Effect of Heating Time on Atrazine-Based MIP Materials Synthesized via the Cooling-Heating Method; Preparation of Orange Peel Based Activated Carbons as Cathodes in Lithium Ion Capacitors; Synthesis of Fe2O3/C Nanocomposite Using Microwave Assisted Calcination Method; Magnetic CuFe2O4 Nanoparticles for Adsorpstion of Cr(VI) from Aqueous Solution Optical Properties of Zn-Doped CeO2 Nanoparticles as a Function of Zn ContentChelating Agent Role in Synthesizing Cerate-Zirconate Powder by a Sol-Gel Method; Influence of Ionic Surfactants under Ultrasonic Irradiation to Reduce the Particle Size of Mechanically Alloyed La1-XSrX Fe0.5Mn0.25Ti0.25O3 Powders; Covalent Functionalization of Amino Group onto Carbon-Based Magnetic Nanoparticles Using Pulsed-Powder Explosion Technique; Magnetic Properties and Microstructures of Polyethylene Glycol (PEG)-Coated Cobalt Ferrite (CoFe2O4) Nanoparticles Synthesized by Coprecipitation Method Collection of selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia. The 157 papers are grouped as follows: Chapter 1: Nanofibers and Membranes, Chapter 2: Nanoparticles and Powders, Chapter 3: Thick and Thin Films, Chapter 4: Biomaterials, Chapter 5: Electronic Materials, Chapter 6: Magnetic Materials, Chapter 7: Optical Materials, Chapter 8: Composites, Ceramics, and Alloys, Chapter 9: Measurement and Characterization Techniques. The proceedings of the September 2013 confe |
| ctrlnum | (ZDB-4-EBA)ocn878138258 (OCoLC)878138258 (DE-599)BVBBV043780908 |
| dewey-full | 620.11 |
| dewey-hundreds | 600 - Technology (Applied sciences) |
| dewey-ones | 620 - Engineering and allied operations |
| dewey-raw | 620.11 |
| dewey-search | 620.11 |
| dewey-sort | 3620.11 |
| dewey-tens | 620 - Engineering and allied operations |
| format | Electronic eBook |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>05965nmm a2200541zcb4500</leader><controlfield tag="001">BV043780908</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">00000000000000.0</controlfield><controlfield tag="007">cr|uuu---uuuuu</controlfield><controlfield tag="008">160920s2014 |||| o||u| ||||||eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038264125</subfield><subfield code="9">978-3-03826-412-5</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3038264121</subfield><subfield code="9">3-03826-412-1</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038350316</subfield><subfield code="9">978-3-03835-031-6</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ZDB-4-EBA)ocn878138258</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)878138258</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV043780908</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-1046</subfield><subfield code="a">DE-1047</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">620.11</subfield><subfield code="2">23</subfield></datafield><datafield tag="110" ind1="2" ind2=" "><subfield code="a">International Conference on Advanced Materials Science and Technology <2013, Yogyakarta, Indonesia></subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Advanced materials science and technology</subfield><subfield code="b">selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia</subfield><subfield code="c">edited by Kuwat Triyana [and four others]</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Zurich, Switzerland</subfield><subfield code="b">Trans Tech Publications</subfield><subfield code="c">[2014]</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">© 2014</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (744 pages)</subfield><subfield code="b">illustrations (some color), graphs, photographs</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="0" ind2=" "><subfield code="a">Advanced materials research</subfield><subfield code="v">v. 896</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Online resource; title from PDF title page (ebrary, viewed March 20, 2014)</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Advanced Materials Science and Technology; Preface and Conference Organizers; Table of Contents; Chapter 1: Nanofibers and Membranes; The Role and Prospect of Nanomaterials in Polymeric Membrane for Water and Wastewater Treatment: A State-of-the-Art Overview; Synthesis of Low Fouling Porous Polymeric Membranes; Mass Production of Stacked Styrofoam Nanofibers Using a Multinozzle and Drum Collector Electrospinning System; Transparent and Conductive Fluorinated-Tin Oxide Prepared by Atmospheric Deposition Technique; Gas Sensing Using Static and Dynamic Modes Piezoresistive Microcantilever</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">One-Step Fabrication of Short Nanofibers by Electrospinning: Effect of Needle Size on Nanofiber LengthCarbon Dioxide Permeation Characteristics in Asymmetric Polysulfone Hollow Fiber Membrane: Effect of Constant Heating and Progressive Heating; Electrospinning of Poly(vinyl alcohol)/Chitosan via Multi-Nozzle Spinneret and Drum Collector; A Simple Way of Producing Nano Anatase TiO2 in Polyvinyl Alcohol Fibers; The Crystal Structure, Conductivity Character and Ionic Migration of Samarium Doped-Ceria (SDC) and its Composite with Sodium Carbonate</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Preparation of Sulfonate Grafted Silica/Chitosan-Based Proton Exchange MembraneSynthesis and Characterization of Solid Polymer Electrolyte from N-Succinyl Chitosan and Lithium Perchlorate; Epoxidised Natural Rubber Based Polymer Electrolyte Systems for Electrochemical Device Applications; Eggs Shell Membrane as Natural Separator for Supercapacitor Applications; Titania Coated Ceramic Membrane from Clay and Muntilan Sand for Wastewater Filter Application; Utilization of Fly Ash as Ceramic Support Mixture for the Synthesis of Zeolite Pervaporation Membrane</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Synthesis and Characterization of Nanostructured Tungsten Oxide by Hard Template MethodChapter 2: Nanoparticles and Powders; Excited-State Proton Transfer in Fluorescent Photoactive Yellow Protein Containing 7-Hydroxycoumarin; Effect of Heating Time on Atrazine-Based MIP Materials Synthesized via the Cooling-Heating Method; Preparation of Orange Peel Based Activated Carbons as Cathodes in Lithium Ion Capacitors; Synthesis of Fe2O3/C Nanocomposite Using Microwave Assisted Calcination Method; Magnetic CuFe2O4 Nanoparticles for Adsorpstion of Cr(VI) from Aqueous Solution</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Optical Properties of Zn-Doped CeO2 Nanoparticles as a Function of Zn ContentChelating Agent Role in Synthesizing Cerate-Zirconate Powder by a Sol-Gel Method; Influence of Ionic Surfactants under Ultrasonic Irradiation to Reduce the Particle Size of Mechanically Alloyed La1-XSrX Fe0.5Mn0.25Ti0.25O3 Powders; Covalent Functionalization of Amino Group onto Carbon-Based Magnetic Nanoparticles Using Pulsed-Powder Explosion Technique; Magnetic Properties and Microstructures of Polyethylene Glycol (PEG)-Coated Cobalt Ferrite (CoFe2O4) Nanoparticles Synthesized by Coprecipitation Method</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Collection of selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia. The 157 papers are grouped as follows: Chapter 1: Nanofibers and Membranes, Chapter 2: Nanoparticles and Powders, Chapter 3: Thick and Thin Films, Chapter 4: Biomaterials, Chapter 5: Electronic Materials, Chapter 6: Magnetic Materials, Chapter 7: Optical Materials, Chapter 8: Composites, Ceramics, and Alloys, Chapter 9: Measurement and Characterization Techniques. The proceedings of the September 2013 confe</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING / Engineering (General)</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING / Reference</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Materials science</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Technology</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Materials science</subfield><subfield code="v">Congresses</subfield><subfield code="a">Technology</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)1071861417</subfield><subfield code="a">Konferenzschrift</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Triyana, Kuwat</subfield><subfield code="4">edt</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Druck-Ausgabe</subfield><subfield code="a">Advanced materials science and technology : selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-029191968</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711973</subfield><subfield code="l">FAW01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711973</subfield><subfield code="l">FAW02</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield></record></collection> |
| genre | (DE-588)1071861417 Konferenzschrift gnd-content |
| genre_facet | Konferenzschrift |
| id | DE-604.BV043780908 |
| illustrated | Illustrated |
| indexdate | 2024-07-10T07:34:56Z |
| institution | BVB |
| isbn | 9783038264125 3038264121 9783038350316 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-029191968 |
| oclc_num | 878138258 |
| open_access_boolean | |
| owner | DE-1046 DE-1047 |
| owner_facet | DE-1046 DE-1047 |
| physical | 1 online resource (744 pages) illustrations (some color), graphs, photographs |
| psigel | ZDB-4-EBA ZDB-4-EBA FAW_PDA_EBA |
| publishDate | 2014 |
| publishDateSearch | 2014 |
| publishDateSort | 2014 |
| publisher | Trans Tech Publications |
| record_format | marc |
| series2 | Advanced materials research |
| spelling | International Conference on Advanced Materials Science and Technology <2013, Yogyakarta, Indonesia> Verfasser aut Advanced materials science and technology selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia edited by Kuwat Triyana [and four others] Zurich, Switzerland Trans Tech Publications [2014] © 2014 1 online resource (744 pages) illustrations (some color), graphs, photographs txt rdacontent c rdamedia cr rdacarrier Advanced materials research v. 896 Online resource; title from PDF title page (ebrary, viewed March 20, 2014) Advanced Materials Science and Technology; Preface and Conference Organizers; Table of Contents; Chapter 1: Nanofibers and Membranes; The Role and Prospect of Nanomaterials in Polymeric Membrane for Water and Wastewater Treatment: A State-of-the-Art Overview; Synthesis of Low Fouling Porous Polymeric Membranes; Mass Production of Stacked Styrofoam Nanofibers Using a Multinozzle and Drum Collector Electrospinning System; Transparent and Conductive Fluorinated-Tin Oxide Prepared by Atmospheric Deposition Technique; Gas Sensing Using Static and Dynamic Modes Piezoresistive Microcantilever One-Step Fabrication of Short Nanofibers by Electrospinning: Effect of Needle Size on Nanofiber LengthCarbon Dioxide Permeation Characteristics in Asymmetric Polysulfone Hollow Fiber Membrane: Effect of Constant Heating and Progressive Heating; Electrospinning of Poly(vinyl alcohol)/Chitosan via Multi-Nozzle Spinneret and Drum Collector; A Simple Way of Producing Nano Anatase TiO2 in Polyvinyl Alcohol Fibers; The Crystal Structure, Conductivity Character and Ionic Migration of Samarium Doped-Ceria (SDC) and its Composite with Sodium Carbonate Preparation of Sulfonate Grafted Silica/Chitosan-Based Proton Exchange MembraneSynthesis and Characterization of Solid Polymer Electrolyte from N-Succinyl Chitosan and Lithium Perchlorate; Epoxidised Natural Rubber Based Polymer Electrolyte Systems for Electrochemical Device Applications; Eggs Shell Membrane as Natural Separator for Supercapacitor Applications; Titania Coated Ceramic Membrane from Clay and Muntilan Sand for Wastewater Filter Application; Utilization of Fly Ash as Ceramic Support Mixture for the Synthesis of Zeolite Pervaporation Membrane Synthesis and Characterization of Nanostructured Tungsten Oxide by Hard Template MethodChapter 2: Nanoparticles and Powders; Excited-State Proton Transfer in Fluorescent Photoactive Yellow Protein Containing 7-Hydroxycoumarin; Effect of Heating Time on Atrazine-Based MIP Materials Synthesized via the Cooling-Heating Method; Preparation of Orange Peel Based Activated Carbons as Cathodes in Lithium Ion Capacitors; Synthesis of Fe2O3/C Nanocomposite Using Microwave Assisted Calcination Method; Magnetic CuFe2O4 Nanoparticles for Adsorpstion of Cr(VI) from Aqueous Solution Optical Properties of Zn-Doped CeO2 Nanoparticles as a Function of Zn ContentChelating Agent Role in Synthesizing Cerate-Zirconate Powder by a Sol-Gel Method; Influence of Ionic Surfactants under Ultrasonic Irradiation to Reduce the Particle Size of Mechanically Alloyed La1-XSrX Fe0.5Mn0.25Ti0.25O3 Powders; Covalent Functionalization of Amino Group onto Carbon-Based Magnetic Nanoparticles Using Pulsed-Powder Explosion Technique; Magnetic Properties and Microstructures of Polyethylene Glycol (PEG)-Coated Cobalt Ferrite (CoFe2O4) Nanoparticles Synthesized by Coprecipitation Method Collection of selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia. The 157 papers are grouped as follows: Chapter 1: Nanofibers and Membranes, Chapter 2: Nanoparticles and Powders, Chapter 3: Thick and Thin Films, Chapter 4: Biomaterials, Chapter 5: Electronic Materials, Chapter 6: Magnetic Materials, Chapter 7: Optical Materials, Chapter 8: Composites, Ceramics, and Alloys, Chapter 9: Measurement and Characterization Techniques. The proceedings of the September 2013 confe TECHNOLOGY & ENGINEERING / Engineering (General) bisacsh TECHNOLOGY & ENGINEERING / Reference bisacsh Materials science fast Technology fast Materials science Congresses Technology Congresses (DE-588)1071861417 Konferenzschrift gnd-content Triyana, Kuwat edt Erscheint auch als Druck-Ausgabe Advanced materials science and technology : selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia |
| spellingShingle | Advanced materials science and technology selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia Advanced Materials Science and Technology; Preface and Conference Organizers; Table of Contents; Chapter 1: Nanofibers and Membranes; The Role and Prospect of Nanomaterials in Polymeric Membrane for Water and Wastewater Treatment: A State-of-the-Art Overview; Synthesis of Low Fouling Porous Polymeric Membranes; Mass Production of Stacked Styrofoam Nanofibers Using a Multinozzle and Drum Collector Electrospinning System; Transparent and Conductive Fluorinated-Tin Oxide Prepared by Atmospheric Deposition Technique; Gas Sensing Using Static and Dynamic Modes Piezoresistive Microcantilever One-Step Fabrication of Short Nanofibers by Electrospinning: Effect of Needle Size on Nanofiber LengthCarbon Dioxide Permeation Characteristics in Asymmetric Polysulfone Hollow Fiber Membrane: Effect of Constant Heating and Progressive Heating; Electrospinning of Poly(vinyl alcohol)/Chitosan via Multi-Nozzle Spinneret and Drum Collector; A Simple Way of Producing Nano Anatase TiO2 in Polyvinyl Alcohol Fibers; The Crystal Structure, Conductivity Character and Ionic Migration of Samarium Doped-Ceria (SDC) and its Composite with Sodium Carbonate Preparation of Sulfonate Grafted Silica/Chitosan-Based Proton Exchange MembraneSynthesis and Characterization of Solid Polymer Electrolyte from N-Succinyl Chitosan and Lithium Perchlorate; Epoxidised Natural Rubber Based Polymer Electrolyte Systems for Electrochemical Device Applications; Eggs Shell Membrane as Natural Separator for Supercapacitor Applications; Titania Coated Ceramic Membrane from Clay and Muntilan Sand for Wastewater Filter Application; Utilization of Fly Ash as Ceramic Support Mixture for the Synthesis of Zeolite Pervaporation Membrane Synthesis and Characterization of Nanostructured Tungsten Oxide by Hard Template MethodChapter 2: Nanoparticles and Powders; Excited-State Proton Transfer in Fluorescent Photoactive Yellow Protein Containing 7-Hydroxycoumarin; Effect of Heating Time on Atrazine-Based MIP Materials Synthesized via the Cooling-Heating Method; Preparation of Orange Peel Based Activated Carbons as Cathodes in Lithium Ion Capacitors; Synthesis of Fe2O3/C Nanocomposite Using Microwave Assisted Calcination Method; Magnetic CuFe2O4 Nanoparticles for Adsorpstion of Cr(VI) from Aqueous Solution Optical Properties of Zn-Doped CeO2 Nanoparticles as a Function of Zn ContentChelating Agent Role in Synthesizing Cerate-Zirconate Powder by a Sol-Gel Method; Influence of Ionic Surfactants under Ultrasonic Irradiation to Reduce the Particle Size of Mechanically Alloyed La1-XSrX Fe0.5Mn0.25Ti0.25O3 Powders; Covalent Functionalization of Amino Group onto Carbon-Based Magnetic Nanoparticles Using Pulsed-Powder Explosion Technique; Magnetic Properties and Microstructures of Polyethylene Glycol (PEG)-Coated Cobalt Ferrite (CoFe2O4) Nanoparticles Synthesized by Coprecipitation Method Collection of selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia. The 157 papers are grouped as follows: Chapter 1: Nanofibers and Membranes, Chapter 2: Nanoparticles and Powders, Chapter 3: Thick and Thin Films, Chapter 4: Biomaterials, Chapter 5: Electronic Materials, Chapter 6: Magnetic Materials, Chapter 7: Optical Materials, Chapter 8: Composites, Ceramics, and Alloys, Chapter 9: Measurement and Characterization Techniques. The proceedings of the September 2013 confe TECHNOLOGY & ENGINEERING / Engineering (General) bisacsh TECHNOLOGY & ENGINEERING / Reference bisacsh Materials science fast Technology fast Materials science Congresses Technology Congresses |
| subject_GND | (DE-588)1071861417 |
| title | Advanced materials science and technology selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia |
| title_auth | Advanced materials science and technology selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia |
| title_exact_search | Advanced materials science and technology selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia |
| title_full | Advanced materials science and technology selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia edited by Kuwat Triyana [and four others] |
| title_fullStr | Advanced materials science and technology selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia edited by Kuwat Triyana [and four others] |
| title_full_unstemmed | Advanced materials science and technology selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia edited by Kuwat Triyana [and four others] |
| title_short | Advanced materials science and technology |
| title_sort | advanced materials science and technology selected peer reviewed papers from the 2013 international conference on advanced materials science and technology icamst 2013 september 17 18 2013 yogyakarta indonesia |
| title_sub | selected, peer reviewed papers from the 2013 International Conference on Advanced Materials Science and Technology (ICAMST 2013), September 17-18, 2013, Yogyakarta, Indonesia |
| topic | TECHNOLOGY & ENGINEERING / Engineering (General) bisacsh TECHNOLOGY & ENGINEERING / Reference bisacsh Materials science fast Technology fast Materials science Congresses Technology Congresses |
| topic_facet | TECHNOLOGY & ENGINEERING / Engineering (General) TECHNOLOGY & ENGINEERING / Reference Materials science Technology Materials science Congresses Technology Congresses Konferenzschrift |
| work_keys_str_mv | AT internationalconferenceonadvancedmaterialsscienceandtechnology2013yogyakartaindonesia advancedmaterialsscienceandtechnologyselectedpeerreviewedpapersfromthe2013internationalconferenceonadvancedmaterialsscienceandtechnologyicamst2013september17182013yogyakartaindonesia AT triyanakuwat advancedmaterialsscienceandtechnologyselectedpeerreviewedpapersfromthe2013internationalconferenceonadvancedmaterialsscienceandtechnologyicamst2013september17182013yogyakartaindonesia |