Mechatronic systems and automation systems: selected, peer reviewed papers of the 2011 International Conference on Mechatronic Systems and Automation Systems (MSAS 2011), will be held on July 23-24, 2011 in Xi'an, China
Gespeichert in:
| Körperschaft: | |
|---|---|
| Format: | Elektronisch E-Book |
| Sprache: | English |
| Veröffentlicht: |
Durnten-Zurich, Switzerland
TTP, Trans Tech Publications
©2011
|
| Schriftenreihe: | Applied mechanics and materials
v. 65 |
| Schlagworte: | |
| Online-Zugang: | FAW01 FAW02 |
| Beschreibung: | Includes bibliographical references and indexes Mechatronic Systems and Automation Systems; Preface; Table of Contents; Study and Development of CAPP Template Customization System; Research on the Influence of Noise to Weak Signal Detection Based on Duffing Equation; Time-Varying Delay Global Stability of Neural Networks; The Application Research of Detecting Weak Random Binary Code Based on Stochastic Resonance; Effect of the Content of Air Bubble in Oil on Forces of Vane in High Pressure Vane Pump; Ontology Mapping Based on Domain Framework; The Absorption Factor of the Wafer for Normal Incidence Vibration Measurement Based on the Michelson InterferometerThe Analysis and Discussion about Green Supply Chain Management of Oil Industry in China; An Intelligent Remote Controller for Household Appliances; Cost Forecast Model Research Based on Trend Extrapolation; A Signal Processing Circuit for Shock Wave Pressure Sensor; Grid-Based Method and Wavelet Transform Fusion of Rapid Detection of Fabric Defects; Vibration Isolation Failure Analysis and Dynamic Characteristic Optimization of NVD Mecha Based on ALGOR; Analysis and Research on Structural Dynamics of Three-Axis Flight Simulator Application of the Predictive and Inferential Control to Pulp Washing ProcessAxial and Circumferential Automatic Chromatographic Control System of Gravure Printing Machine; Numerical Simulation of Inner Flow Yield of Turbulence Generator of Papermachine Headbox and Structure Optimal Design; Research on Fuzzy Control Algorithm with Double Parameters Detection of Micro-EDM; Sensitivity Analysis of DVG850 High-Speed Vertical Machining Center Headstock; Machining Center Worktable Static Stiffness Spectrum Drawing and Analysis; Research on Servo Controller for High Speed Tracking System A Concise Method of Characteristic Analysis for Sciences Universal MachineA Simple Magnetizing Characteristic Model for the Transformer; Research on Integrated Scheduling Model of Automated High-Rise Warehouse and Traditional Flat Storehouse for Cigarette Distribution Center; A Digital Watermarking Method by Double Encryption Based on Arnold and Chaos in DCT Domain; Multi-Resolution Analysis of the Acousto-Ultrasonic Testing Signal for Composite Material Detection; Implementation of Video Capture Based on DirectShow Technology Research on the Remote Monitoring and Control System for Heating Supply Pipeline Based on GPRS and ZigBeeA Design of High Smart Pressure Sensor Based on Microcontroller and BP Network; Study on the Present Condition and it'S Key Technique to Prospect of the High Frequency Resonance Transform Using in Electrostatic Dust Separator; Dual-Mode Solar Tracking Controller; Fabrication of Super-Hydrophobic Textile Surface with Aminopolysiloxane and Nano-Silica via a Solution Immersion Process; The Design of High-Precision Pressure Transmitter Based on MSP430 Microcontroller This collection gathers together new research results on mechatronic and automation systems; bringing together worldwide industrial and academic researchers, developers and users and their state-of-the-art results. This work will help to lead to the exploration of new areas of research and development, and to discussions of the emerging issues facing mechatronic and automation systems. Review from Book News Inc.: This volume contains the proceedings of the July 2011 International Conference on Mechatronic Systems and Automation Systems, held in Xi'an, China. Approximately 100 peer-reviewed pap |
| Beschreibung: | xiv, 638 pages |
| ISBN: | 9783038135357 3038135356 9783037851845 3037851848 |
Internformat
MARC
| LEADER | 00000nmm a2200000zcb4500 | ||
|---|---|---|---|
| 001 | BV043775797 | ||
| 003 | DE-604 | ||
| 005 | 00000000000000.0 | ||
| 007 | cr|uuu---uuuuu | ||
| 008 | 160920s2011 |||| o||u| ||||||eng d | ||
| 020 | |a 9783038135357 |9 978-3-03813-535-7 | ||
| 020 | |a 3038135356 |9 3-03813-535-6 | ||
| 020 | |a 9783037851845 |9 978-3-03785-184-5 | ||
| 020 | |a 3037851848 |9 3-03785-184-8 | ||
| 035 | |a (ZDB-4-EBA)ocn837631867 | ||
| 035 | |a (OCoLC)837631867 | ||
| 035 | |a (DE-599)BVBBV043775797 | ||
| 040 | |a DE-604 |b ger |e aacr | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-1046 |a DE-1047 | ||
| 082 | 0 | |a 621 |2 23 | |
| 110 | 2 | |a International Conference on Mechatronic Systems and Automation Systems <2011, Xi'an, China> |e Verfasser |4 aut | |
| 245 | 1 | 0 | |a Mechatronic systems and automation systems |b selected, peer reviewed papers of the 2011 International Conference on Mechatronic Systems and Automation Systems (MSAS 2011), will be held on July 23-24, 2011 in Xi'an, China |c edited by Zhenyu Du and Bin Liu |
| 246 | 1 | 3 | |a MSAS 2011 |
| 264 | 1 | |a Durnten-Zurich, Switzerland |b TTP, Trans Tech Publications |c ©2011 | |
| 300 | |a xiv, 638 pages | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b c |2 rdamedia | ||
| 338 | |b cr |2 rdacarrier | ||
| 490 | 0 | |a Applied mechanics and materials |v v. 65 | |
| 500 | |a Includes bibliographical references and indexes | ||
| 500 | |a Mechatronic Systems and Automation Systems; Preface; Table of Contents; Study and Development of CAPP Template Customization System; Research on the Influence of Noise to Weak Signal Detection Based on Duffing Equation; Time-Varying Delay Global Stability of Neural Networks; The Application Research of Detecting Weak Random Binary Code Based on Stochastic Resonance; Effect of the Content of Air Bubble in Oil on Forces of Vane in High Pressure Vane Pump; Ontology Mapping Based on Domain Framework; The Absorption Factor of the Wafer for Normal Incidence | ||
| 500 | |a Vibration Measurement Based on the Michelson InterferometerThe Analysis and Discussion about Green Supply Chain Management of Oil Industry in China; An Intelligent Remote Controller for Household Appliances; Cost Forecast Model Research Based on Trend Extrapolation; A Signal Processing Circuit for Shock Wave Pressure Sensor; Grid-Based Method and Wavelet Transform Fusion of Rapid Detection of Fabric Defects; Vibration Isolation Failure Analysis and Dynamic Characteristic Optimization of NVD Mecha Based on ALGOR; Analysis and Research on Structural Dynamics of Three-Axis Flight Simulator | ||
| 500 | |a Application of the Predictive and Inferential Control to Pulp Washing ProcessAxial and Circumferential Automatic Chromatographic Control System of Gravure Printing Machine; Numerical Simulation of Inner Flow Yield of Turbulence Generator of Papermachine Headbox and Structure Optimal Design; Research on Fuzzy Control Algorithm with Double Parameters Detection of Micro-EDM; Sensitivity Analysis of DVG850 High-Speed Vertical Machining Center Headstock; Machining Center Worktable Static Stiffness Spectrum Drawing and Analysis; Research on Servo Controller for High Speed Tracking System | ||
| 500 | |a A Concise Method of Characteristic Analysis for Sciences Universal MachineA Simple Magnetizing Characteristic Model for the Transformer; Research on Integrated Scheduling Model of Automated High-Rise Warehouse and Traditional Flat Storehouse for Cigarette Distribution Center; A Digital Watermarking Method by Double Encryption Based on Arnold and Chaos in DCT Domain; Multi-Resolution Analysis of the Acousto-Ultrasonic Testing Signal for Composite Material Detection; Implementation of Video Capture Based on DirectShow Technology | ||
| 500 | |a Research on the Remote Monitoring and Control System for Heating Supply Pipeline Based on GPRS and ZigBeeA Design of High Smart Pressure Sensor Based on Microcontroller and BP Network; Study on the Present Condition and it'S Key Technique to Prospect of the High Frequency Resonance Transform Using in Electrostatic Dust Separator; Dual-Mode Solar Tracking Controller; Fabrication of Super-Hydrophobic Textile Surface with Aminopolysiloxane and Nano-Silica via a Solution Immersion Process; The Design of High-Precision Pressure Transmitter Based on MSP430 Microcontroller | ||
| 500 | |a This collection gathers together new research results on mechatronic and automation systems; bringing together worldwide industrial and academic researchers, developers and users and their state-of-the-art results. This work will help to lead to the exploration of new areas of research and development, and to discussions of the emerging issues facing mechatronic and automation systems. Review from Book News Inc.: This volume contains the proceedings of the July 2011 International Conference on Mechatronic Systems and Automation Systems, held in Xi'an, China. Approximately 100 peer-reviewed pap | ||
| 650 | 7 | |a TECHNOLOGY & ENGINEERING / Mechanical |2 bisacsh | |
| 650 | 7 | |a Intelligent control systems |2 fast | |
| 650 | 7 | |a Mechatronics |2 fast | |
| 650 | 7 | |a Robotics |2 fast | |
| 650 | 4 | |a Mechatronics |v Congresses | |
| 650 | 4 | |a Intelligent control systems |v Congresses | |
| 650 | 4 | |a Robotics |v Congresses | |
| 655 | 7 | |0 (DE-588)1071861417 |a Konferenzschrift |2 gnd-content | |
| 700 | 1 | |a Du, Zhenyu |e Sonstige |4 oth | |
| 700 | 1 | |a Liu, Bin |e Sonstige |4 oth | |
| 912 | |a ZDB-4-EBA | ||
| 999 | |a oai:aleph.bib-bvb.de:BVB01-029186857 | ||
| 966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=553188 |l FAW01 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext | |
| 966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=553188 |l FAW02 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext | |
Datensatz im Suchindex
| _version_ | 1804176601888325632 |
|---|---|
| any_adam_object | |
| author_corporate | International Conference on Mechatronic Systems and Automation Systems <2011, Xi'an, China> |
| author_corporate_role | aut |
| author_facet | International Conference on Mechatronic Systems and Automation Systems <2011, Xi'an, China> |
| author_sort | International Conference on Mechatronic Systems and Automation Systems <2011, Xi'an, China> |
| building | Verbundindex |
| bvnumber | BV043775797 |
| collection | ZDB-4-EBA |
| ctrlnum | (ZDB-4-EBA)ocn837631867 (OCoLC)837631867 (DE-599)BVBBV043775797 |
| dewey-full | 621 |
| dewey-hundreds | 600 - Technology (Applied sciences) |
| dewey-ones | 621 - Applied physics |
| dewey-raw | 621 |
| dewey-search | 621 |
| dewey-sort | 3621 |
| dewey-tens | 620 - Engineering and allied operations |
| format | Electronic eBook |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>05709nmm a2200577zcb4500</leader><controlfield tag="001">BV043775797</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">00000000000000.0</controlfield><controlfield tag="007">cr|uuu---uuuuu</controlfield><controlfield tag="008">160920s2011 |||| o||u| ||||||eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038135357</subfield><subfield code="9">978-3-03813-535-7</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3038135356</subfield><subfield code="9">3-03813-535-6</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783037851845</subfield><subfield code="9">978-3-03785-184-5</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3037851848</subfield><subfield code="9">3-03785-184-8</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ZDB-4-EBA)ocn837631867</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)837631867</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV043775797</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">aacr</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-1046</subfield><subfield code="a">DE-1047</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">621</subfield><subfield code="2">23</subfield></datafield><datafield tag="110" ind1="2" ind2=" "><subfield code="a">International Conference on Mechatronic Systems and Automation Systems <2011, Xi'an, China></subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Mechatronic systems and automation systems</subfield><subfield code="b">selected, peer reviewed papers of the 2011 International Conference on Mechatronic Systems and Automation Systems (MSAS 2011), will be held on July 23-24, 2011 in Xi'an, China</subfield><subfield code="c">edited by Zhenyu Du and Bin Liu</subfield></datafield><datafield tag="246" ind1="1" ind2="3"><subfield code="a">MSAS 2011</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Durnten-Zurich, Switzerland</subfield><subfield code="b">TTP, Trans Tech Publications</subfield><subfield code="c">©2011</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">xiv, 638 pages</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="0" ind2=" "><subfield code="a">Applied mechanics and materials</subfield><subfield code="v">v. 65</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references and indexes</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Mechatronic Systems and Automation Systems; Preface; Table of Contents; Study and Development of CAPP Template Customization System; Research on the Influence of Noise to Weak Signal Detection Based on Duffing Equation; Time-Varying Delay Global Stability of Neural Networks; The Application Research of Detecting Weak Random Binary Code Based on Stochastic Resonance; Effect of the Content of Air Bubble in Oil on Forces of Vane in High Pressure Vane Pump; Ontology Mapping Based on Domain Framework; The Absorption Factor of the Wafer for Normal Incidence</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Vibration Measurement Based on the Michelson InterferometerThe Analysis and Discussion about Green Supply Chain Management of Oil Industry in China; An Intelligent Remote Controller for Household Appliances; Cost Forecast Model Research Based on Trend Extrapolation; A Signal Processing Circuit for Shock Wave Pressure Sensor; Grid-Based Method and Wavelet Transform Fusion of Rapid Detection of Fabric Defects; Vibration Isolation Failure Analysis and Dynamic Characteristic Optimization of NVD Mecha Based on ALGOR; Analysis and Research on Structural Dynamics of Three-Axis Flight Simulator</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Application of the Predictive and Inferential Control to Pulp Washing ProcessAxial and Circumferential Automatic Chromatographic Control System of Gravure Printing Machine; Numerical Simulation of Inner Flow Yield of Turbulence Generator of Papermachine Headbox and Structure Optimal Design; Research on Fuzzy Control Algorithm with Double Parameters Detection of Micro-EDM; Sensitivity Analysis of DVG850 High-Speed Vertical Machining Center Headstock; Machining Center Worktable Static Stiffness Spectrum Drawing and Analysis; Research on Servo Controller for High Speed Tracking System</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">A Concise Method of Characteristic Analysis for Sciences Universal MachineA Simple Magnetizing Characteristic Model for the Transformer; Research on Integrated Scheduling Model of Automated High-Rise Warehouse and Traditional Flat Storehouse for Cigarette Distribution Center; A Digital Watermarking Method by Double Encryption Based on Arnold and Chaos in DCT Domain; Multi-Resolution Analysis of the Acousto-Ultrasonic Testing Signal for Composite Material Detection; Implementation of Video Capture Based on DirectShow Technology</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Research on the Remote Monitoring and Control System for Heating Supply Pipeline Based on GPRS and ZigBeeA Design of High Smart Pressure Sensor Based on Microcontroller and BP Network; Study on the Present Condition and it'S Key Technique to Prospect of the High Frequency Resonance Transform Using in Electrostatic Dust Separator; Dual-Mode Solar Tracking Controller; Fabrication of Super-Hydrophobic Textile Surface with Aminopolysiloxane and Nano-Silica via a Solution Immersion Process; The Design of High-Precision Pressure Transmitter Based on MSP430 Microcontroller</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">This collection gathers together new research results on mechatronic and automation systems; bringing together worldwide industrial and academic researchers, developers and users and their state-of-the-art results. This work will help to lead to the exploration of new areas of research and development, and to discussions of the emerging issues facing mechatronic and automation systems. Review from Book News Inc.: This volume contains the proceedings of the July 2011 International Conference on Mechatronic Systems and Automation Systems, held in Xi'an, China. Approximately 100 peer-reviewed pap</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING / Mechanical</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Intelligent control systems</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Mechatronics</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Robotics</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Mechatronics</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Intelligent control systems</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Robotics</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)1071861417</subfield><subfield code="a">Konferenzschrift</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Du, Zhenyu</subfield><subfield code="e">Sonstige</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Liu, Bin</subfield><subfield code="e">Sonstige</subfield><subfield code="4">oth</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-029186857</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=553188</subfield><subfield code="l">FAW01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=553188</subfield><subfield code="l">FAW02</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield></record></collection> |
| genre | (DE-588)1071861417 Konferenzschrift gnd-content |
| genre_facet | Konferenzschrift |
| id | DE-604.BV043775797 |
| illustrated | Not Illustrated |
| indexdate | 2024-07-10T07:34:47Z |
| institution | BVB |
| isbn | 9783038135357 3038135356 9783037851845 3037851848 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-029186857 |
| oclc_num | 837631867 |
| open_access_boolean | |
| owner | DE-1046 DE-1047 |
| owner_facet | DE-1046 DE-1047 |
| physical | xiv, 638 pages |
| psigel | ZDB-4-EBA ZDB-4-EBA FAW_PDA_EBA |
| publishDate | 2011 |
| publishDateSearch | 2011 |
| publishDateSort | 2011 |
| publisher | TTP, Trans Tech Publications |
| record_format | marc |
| series2 | Applied mechanics and materials |
| spelling | International Conference on Mechatronic Systems and Automation Systems <2011, Xi'an, China> Verfasser aut Mechatronic systems and automation systems selected, peer reviewed papers of the 2011 International Conference on Mechatronic Systems and Automation Systems (MSAS 2011), will be held on July 23-24, 2011 in Xi'an, China edited by Zhenyu Du and Bin Liu MSAS 2011 Durnten-Zurich, Switzerland TTP, Trans Tech Publications ©2011 xiv, 638 pages txt rdacontent c rdamedia cr rdacarrier Applied mechanics and materials v. 65 Includes bibliographical references and indexes Mechatronic Systems and Automation Systems; Preface; Table of Contents; Study and Development of CAPP Template Customization System; Research on the Influence of Noise to Weak Signal Detection Based on Duffing Equation; Time-Varying Delay Global Stability of Neural Networks; The Application Research of Detecting Weak Random Binary Code Based on Stochastic Resonance; Effect of the Content of Air Bubble in Oil on Forces of Vane in High Pressure Vane Pump; Ontology Mapping Based on Domain Framework; The Absorption Factor of the Wafer for Normal Incidence Vibration Measurement Based on the Michelson InterferometerThe Analysis and Discussion about Green Supply Chain Management of Oil Industry in China; An Intelligent Remote Controller for Household Appliances; Cost Forecast Model Research Based on Trend Extrapolation; A Signal Processing Circuit for Shock Wave Pressure Sensor; Grid-Based Method and Wavelet Transform Fusion of Rapid Detection of Fabric Defects; Vibration Isolation Failure Analysis and Dynamic Characteristic Optimization of NVD Mecha Based on ALGOR; Analysis and Research on Structural Dynamics of Three-Axis Flight Simulator Application of the Predictive and Inferential Control to Pulp Washing ProcessAxial and Circumferential Automatic Chromatographic Control System of Gravure Printing Machine; Numerical Simulation of Inner Flow Yield of Turbulence Generator of Papermachine Headbox and Structure Optimal Design; Research on Fuzzy Control Algorithm with Double Parameters Detection of Micro-EDM; Sensitivity Analysis of DVG850 High-Speed Vertical Machining Center Headstock; Machining Center Worktable Static Stiffness Spectrum Drawing and Analysis; Research on Servo Controller for High Speed Tracking System A Concise Method of Characteristic Analysis for Sciences Universal MachineA Simple Magnetizing Characteristic Model for the Transformer; Research on Integrated Scheduling Model of Automated High-Rise Warehouse and Traditional Flat Storehouse for Cigarette Distribution Center; A Digital Watermarking Method by Double Encryption Based on Arnold and Chaos in DCT Domain; Multi-Resolution Analysis of the Acousto-Ultrasonic Testing Signal for Composite Material Detection; Implementation of Video Capture Based on DirectShow Technology Research on the Remote Monitoring and Control System for Heating Supply Pipeline Based on GPRS and ZigBeeA Design of High Smart Pressure Sensor Based on Microcontroller and BP Network; Study on the Present Condition and it'S Key Technique to Prospect of the High Frequency Resonance Transform Using in Electrostatic Dust Separator; Dual-Mode Solar Tracking Controller; Fabrication of Super-Hydrophobic Textile Surface with Aminopolysiloxane and Nano-Silica via a Solution Immersion Process; The Design of High-Precision Pressure Transmitter Based on MSP430 Microcontroller This collection gathers together new research results on mechatronic and automation systems; bringing together worldwide industrial and academic researchers, developers and users and their state-of-the-art results. This work will help to lead to the exploration of new areas of research and development, and to discussions of the emerging issues facing mechatronic and automation systems. Review from Book News Inc.: This volume contains the proceedings of the July 2011 International Conference on Mechatronic Systems and Automation Systems, held in Xi'an, China. Approximately 100 peer-reviewed pap TECHNOLOGY & ENGINEERING / Mechanical bisacsh Intelligent control systems fast Mechatronics fast Robotics fast Mechatronics Congresses Intelligent control systems Congresses Robotics Congresses (DE-588)1071861417 Konferenzschrift gnd-content Du, Zhenyu Sonstige oth Liu, Bin Sonstige oth |
| spellingShingle | Mechatronic systems and automation systems selected, peer reviewed papers of the 2011 International Conference on Mechatronic Systems and Automation Systems (MSAS 2011), will be held on July 23-24, 2011 in Xi'an, China TECHNOLOGY & ENGINEERING / Mechanical bisacsh Intelligent control systems fast Mechatronics fast Robotics fast Mechatronics Congresses Intelligent control systems Congresses Robotics Congresses |
| subject_GND | (DE-588)1071861417 |
| title | Mechatronic systems and automation systems selected, peer reviewed papers of the 2011 International Conference on Mechatronic Systems and Automation Systems (MSAS 2011), will be held on July 23-24, 2011 in Xi'an, China |
| title_alt | MSAS 2011 |
| title_auth | Mechatronic systems and automation systems selected, peer reviewed papers of the 2011 International Conference on Mechatronic Systems and Automation Systems (MSAS 2011), will be held on July 23-24, 2011 in Xi'an, China |
| title_exact_search | Mechatronic systems and automation systems selected, peer reviewed papers of the 2011 International Conference on Mechatronic Systems and Automation Systems (MSAS 2011), will be held on July 23-24, 2011 in Xi'an, China |
| title_full | Mechatronic systems and automation systems selected, peer reviewed papers of the 2011 International Conference on Mechatronic Systems and Automation Systems (MSAS 2011), will be held on July 23-24, 2011 in Xi'an, China edited by Zhenyu Du and Bin Liu |
| title_fullStr | Mechatronic systems and automation systems selected, peer reviewed papers of the 2011 International Conference on Mechatronic Systems and Automation Systems (MSAS 2011), will be held on July 23-24, 2011 in Xi'an, China edited by Zhenyu Du and Bin Liu |
| title_full_unstemmed | Mechatronic systems and automation systems selected, peer reviewed papers of the 2011 International Conference on Mechatronic Systems and Automation Systems (MSAS 2011), will be held on July 23-24, 2011 in Xi'an, China edited by Zhenyu Du and Bin Liu |
| title_short | Mechatronic systems and automation systems |
| title_sort | mechatronic systems and automation systems selected peer reviewed papers of the 2011 international conference on mechatronic systems and automation systems msas 2011 will be held on july 23 24 2011 in xi an china |
| title_sub | selected, peer reviewed papers of the 2011 International Conference on Mechatronic Systems and Automation Systems (MSAS 2011), will be held on July 23-24, 2011 in Xi'an, China |
| topic | TECHNOLOGY & ENGINEERING / Mechanical bisacsh Intelligent control systems fast Mechatronics fast Robotics fast Mechatronics Congresses Intelligent control systems Congresses Robotics Congresses |
| topic_facet | TECHNOLOGY & ENGINEERING / Mechanical Intelligent control systems Mechatronics Robotics Mechatronics Congresses Intelligent control systems Congresses Robotics Congresses Konferenzschrift |
| work_keys_str_mv | AT internationalconferenceonmechatronicsystemsandautomationsystems2011xianchina mechatronicsystemsandautomationsystemsselectedpeerreviewedpapersofthe2011internationalconferenceonmechatronicsystemsandautomationsystemsmsas2011willbeheldonjuly23242011inxianchina AT duzhenyu mechatronicsystemsandautomationsystemsselectedpeerreviewedpapersofthe2011internationalconferenceonmechatronicsystemsandautomationsystemsmsas2011willbeheldonjuly23242011inxianchina AT liubin mechatronicsystemsandautomationsystemsselectedpeerreviewedpapersofthe2011internationalconferenceonmechatronicsystemsandautomationsystemsmsas2011willbeheldonjuly23242011inxianchina AT internationalconferenceonmechatronicsystemsandautomationsystems2011xianchina msas2011 AT duzhenyu msas2011 AT liubin msas2011 |