What would animals say if we asked the right questions?:
Gespeichert in:
1. Verfasser: | |
---|---|
Weitere Verfasser: | |
Format: | Buch |
Sprache: | English |
Veröffentlicht: |
Minneapolis ; London
University of Minnesota Press
[2016]
|
Schriftenreihe: | Posthumanities
38 |
Schlagworte: | |
Online-Zugang: | Inhaltsverzeichnis Klappentext |
Beschreibung: | Includes bibliographical references and index |
Beschreibung: | xix, 249 Seiten |
ISBN: | 9780816692378 9780816692392 |
Internformat
MARC
LEADER | 00000nam a2200000 cb4500 | ||
---|---|---|---|
001 | BV043725482 | ||
003 | DE-604 | ||
005 | 20240209 | ||
007 | t| | ||
008 | 160819s2016 xxu |||| 00||| eng d | ||
010 | |a 015036886 | ||
020 | |a 9780816692378 |c hardback |9 978-0-8166-9237-8 | ||
020 | |a 9780816692392 |c paperback |9 978-0-8166-9239-2 | ||
035 | |a (OCoLC)940940975 | ||
035 | |a (DE-599)BVBBV043725482 | ||
040 | |a DE-604 |b ger |e rda | ||
041 | 0 | |a eng | |
044 | |a xxu |c US | ||
049 | |a DE-384 |a DE-11 |a DE-521 |a DE-19 | ||
050 | 0 | |a QL751 | |
082 | 0 | |a 591.5 |2 23 | |
084 | |a CZ 8000 |0 (DE-625)19241: |2 rvk | ||
100 | 1 | |a Despret, Vinciane |d 1959- |e Verfasser |0 (DE-588)1152216481 |4 aut | |
240 | 1 | 0 | |a Que diraient les animaux, si... on leur posait les bonnes questions? |
245 | 1 | 0 | |a What would animals say if we asked the right questions? |c Vinciane Despret ; translated by Brett Buchanan ; foreword by Bruno Latour |
264 | 1 | |a Minneapolis ; London |b University of Minnesota Press |c [2016] | |
264 | 4 | |c © 2016 | |
300 | |a xix, 249 Seiten | ||
336 | |b txt |2 rdacontent | ||
337 | |b n |2 rdamedia | ||
338 | |b nc |2 rdacarrier | ||
490 | 1 | |a Posthumanities |v 38 | |
500 | |a Includes bibliographical references and index | ||
650 | 4 | |a Animal behavior |v Miscellanea | |
650 | 0 | 7 | |a Philosophie |0 (DE-588)4045791-6 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Tiere |0 (DE-588)4060087-7 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Tierpsychologie |0 (DE-588)4185497-4 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Verhalten |0 (DE-588)4062860-7 |2 gnd |9 rswk-swf |
689 | 0 | 0 | |a Tierpsychologie |0 (DE-588)4185497-4 |D s |
689 | 0 | |5 DE-604 | |
689 | 1 | 0 | |a Tiere |0 (DE-588)4060087-7 |D s |
689 | 1 | 1 | |a Verhalten |0 (DE-588)4062860-7 |D s |
689 | 1 | |8 1\p |5 DE-604 | |
689 | 2 | 0 | |a Tiere |0 (DE-588)4060087-7 |D s |
689 | 2 | 1 | |a Philosophie |0 (DE-588)4045791-6 |D s |
689 | 2 | |8 2\p |5 DE-604 | |
700 | 1 | |a Buchanan, Brett |d 1975- |0 (DE-588)13793159X |4 trl | |
700 | 1 | |a Latour, Bruno |d 1947-2022 |0 (DE-588)119404923 |4 wpr | |
830 | 0 | |a Posthumanities |v 38 |w (DE-604)BV022621177 |9 38 | |
856 | 4 | 2 | |m Digitalisierung UB Augsburg - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029137458&sequence=000003&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
856 | 4 | 2 | |m Digitalisierung UB Augsburg - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029137458&sequence=000004&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |3 Klappentext |
883 | 1 | |8 1\p |a cgwrk |d 20201028 |q DE-101 |u https://d-nb.info/provenance/plan#cgwrk | |
883 | 1 | |8 2\p |a cgwrk |d 20201028 |q DE-101 |u https://d-nb.info/provenance/plan#cgwrk | |
943 | 1 | |a oai:aleph.bib-bvb.de:BVB01-029137458 |
Datensatz im Suchindex
_version_ | 1816978834982961152 |
---|---|
adam_text |
Foreword: The Scientific Fables of an Empirical La Fontaine
Bruno Latour. vii
Acknowledgments.xv
How to Use This Book. xvii
Translator s Note.xix
A for Artists: Stupid like a painter?.1
B for Beasts: Do apes really ape?.7
C for Corporeal: Is it all right to urinate in front of animals?.15
D for Delinquents: Can animals revolt?.21
E for Exhibitionists: Do animals see themselves as we see them? . 29
F for Fabricating Science: Do animals have a sense of prestige?.37
G for Genius: With whom would extraterrestrials want to
negotiate?.47
H for Hierarchies: Might the dominance of males be a myth?.53
I for Impaired: Are animals reliable models of morality?.61
J for Justice: Can animals compromise?.71
K for KiUable: Are any species killable?.81
L for Laboratory: What are rats interested in during
experiments?. 89
M for Magpies: How can we interest elephants in mirrors?.97
N for Necessity: Can one lead a rat to infanticide?.105
O for Oeuvres: Do birds make art?.117
P for Pretenders: Can deception be proof of good manners?.123
Q for Queer: Are penguins coming out of the closet?.131
R for Reaction: Do goats agree with statistics?.139
S for Separations: Can animals be broken down?.145
T for Tying Knots: Who invented language and mathematics?.153
U for Umxvelt: Do beasts know ways of being in the world?.161
V for Versions: Do chimpanzees die like we do?.169
W for Work: Why do we say that cows don't do anything?.177
X for Xenografts: Can one live with the heart of a pig?.185
Y for YouTube: Are ahimals the new celebrities?.195
Z for Zoophilia: Can horses consent?.203
Notes.213
Index.243
IS IT ALL RIGHT to urinate in front
of animals? What does It mean when a monkey throws
its feces at you? Do apes really know how to ape? Do
animals form same-sex relations? Are they the new
celebrities of the twenty-first century? This book poses
twenty-six questions that stretch our preconceived ideas
about what animals do, what they think about, and
what they want.
In a delightful abecedarium, Vinciane Despret explores
incredible and often funny adventures about animals and
their relationships with researchers, farmers, zookeepers,
and other human beings and argues that behaviors we
identify as separating humans from animals do not
properly belong to humans. In these stories it is evident
that animals seem to take perverse pleasure in creating
scenarios that unsettle even the greatest of experts, who
in turn invariably conclude that animals are not nearly
as dumb as previously thought. Combining serious
scholarship with humor, this book is a must read not only
for specialists but also for general readers, including dog
owners, who will never look at their canine companions
the same way again. |
any_adam_object | 1 |
author | Despret, Vinciane 1959- |
author2 | Buchanan, Brett 1975- |
author2_role | trl |
author2_variant | b b bb |
author_GND | (DE-588)1152216481 (DE-588)13793159X (DE-588)119404923 |
author_facet | Despret, Vinciane 1959- Buchanan, Brett 1975- |
author_role | aut |
author_sort | Despret, Vinciane 1959- |
author_variant | v d vd |
building | Verbundindex |
bvnumber | BV043725482 |
callnumber-first | Q - Science |
callnumber-label | QL751 |
callnumber-raw | QL751 |
callnumber-search | QL751 |
callnumber-sort | QL 3751 |
callnumber-subject | QL - Zoology |
classification_rvk | CZ 8000 |
ctrlnum | (OCoLC)940940975 (DE-599)BVBBV043725482 |
dewey-full | 591.5 |
dewey-hundreds | 500 - Natural sciences and mathematics |
dewey-ones | 591 - Specific topics in natural history of animals |
dewey-raw | 591.5 |
dewey-search | 591.5 |
dewey-sort | 3591.5 |
dewey-tens | 590 - Animals |
discipline | Biologie Psychologie |
format | Book |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>00000nam a2200000 cb4500</leader><controlfield tag="001">BV043725482</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20240209</controlfield><controlfield tag="007">t|</controlfield><controlfield tag="008">160819s2016 xxu |||| 00||| eng d</controlfield><datafield tag="010" ind1=" " ind2=" "><subfield code="a">015036886</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9780816692378</subfield><subfield code="c">hardback</subfield><subfield code="9">978-0-8166-9237-8</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9780816692392</subfield><subfield code="c">paperback</subfield><subfield code="9">978-0-8166-9239-2</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)940940975</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV043725482</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">xxu</subfield><subfield code="c">US</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-384</subfield><subfield code="a">DE-11</subfield><subfield code="a">DE-521</subfield><subfield code="a">DE-19</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">QL751</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">591.5</subfield><subfield code="2">23</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">CZ 8000</subfield><subfield code="0">(DE-625)19241:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Despret, Vinciane</subfield><subfield code="d">1959-</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1152216481</subfield><subfield code="4">aut</subfield></datafield><datafield tag="240" ind1="1" ind2="0"><subfield code="a">Que diraient les animaux, si... on leur posait les bonnes questions?</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">What would animals say if we asked the right questions?</subfield><subfield code="c">Vinciane Despret ; translated by Brett Buchanan ; foreword by Bruno Latour</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Minneapolis ; London</subfield><subfield code="b">University of Minnesota Press</subfield><subfield code="c">[2016]</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">© 2016</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">xix, 249 Seiten</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Posthumanities</subfield><subfield code="v">38</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references and index</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Animal behavior</subfield><subfield code="v">Miscellanea</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Philosophie</subfield><subfield code="0">(DE-588)4045791-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Tiere</subfield><subfield code="0">(DE-588)4060087-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Tierpsychologie</subfield><subfield code="0">(DE-588)4185497-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Verhalten</subfield><subfield code="0">(DE-588)4062860-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Tierpsychologie</subfield><subfield code="0">(DE-588)4185497-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="1" ind2="0"><subfield code="a">Tiere</subfield><subfield code="0">(DE-588)4060087-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="1"><subfield code="a">Verhalten</subfield><subfield code="0">(DE-588)4062860-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2=" "><subfield code="8">1\p</subfield><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="2" ind2="0"><subfield code="a">Tiere</subfield><subfield code="0">(DE-588)4060087-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="2" ind2="1"><subfield code="a">Philosophie</subfield><subfield code="0">(DE-588)4045791-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="2" ind2=" "><subfield code="8">2\p</subfield><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Buchanan, Brett</subfield><subfield code="d">1975-</subfield><subfield code="0">(DE-588)13793159X</subfield><subfield code="4">trl</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Latour, Bruno</subfield><subfield code="d">1947-2022</subfield><subfield code="0">(DE-588)119404923</subfield><subfield code="4">wpr</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Posthumanities</subfield><subfield code="v">38</subfield><subfield code="w">(DE-604)BV022621177</subfield><subfield code="9">38</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Augsburg - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029137458&sequence=000003&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Augsburg - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029137458&sequence=000004&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Klappentext</subfield></datafield><datafield tag="883" ind1="1" ind2=" "><subfield code="8">1\p</subfield><subfield code="a">cgwrk</subfield><subfield code="d">20201028</subfield><subfield code="q">DE-101</subfield><subfield code="u">https://d-nb.info/provenance/plan#cgwrk</subfield></datafield><datafield tag="883" ind1="1" ind2=" "><subfield code="8">2\p</subfield><subfield code="a">cgwrk</subfield><subfield code="d">20201028</subfield><subfield code="q">DE-101</subfield><subfield code="u">https://d-nb.info/provenance/plan#cgwrk</subfield></datafield><datafield tag="943" ind1="1" ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-029137458</subfield></datafield></record></collection> |
id | DE-604.BV043725482 |
illustrated | Not Illustrated |
indexdate | 2024-11-28T15:00:48Z |
institution | BVB |
isbn | 9780816692378 9780816692392 |
language | English |
lccn | 015036886 |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-029137458 |
oclc_num | 940940975 |
open_access_boolean | |
owner | DE-384 DE-11 DE-521 DE-19 DE-BY-UBM |
owner_facet | DE-384 DE-11 DE-521 DE-19 DE-BY-UBM |
physical | xix, 249 Seiten |
publishDate | 2016 |
publishDateSearch | 2016 |
publishDateSort | 2016 |
publisher | University of Minnesota Press |
record_format | marc |
series | Posthumanities |
series2 | Posthumanities |
spelling | Despret, Vinciane 1959- Verfasser (DE-588)1152216481 aut Que diraient les animaux, si... on leur posait les bonnes questions? What would animals say if we asked the right questions? Vinciane Despret ; translated by Brett Buchanan ; foreword by Bruno Latour Minneapolis ; London University of Minnesota Press [2016] © 2016 xix, 249 Seiten txt rdacontent n rdamedia nc rdacarrier Posthumanities 38 Includes bibliographical references and index Animal behavior Miscellanea Philosophie (DE-588)4045791-6 gnd rswk-swf Tiere (DE-588)4060087-7 gnd rswk-swf Tierpsychologie (DE-588)4185497-4 gnd rswk-swf Verhalten (DE-588)4062860-7 gnd rswk-swf Tierpsychologie (DE-588)4185497-4 s DE-604 Tiere (DE-588)4060087-7 s Verhalten (DE-588)4062860-7 s 1\p DE-604 Philosophie (DE-588)4045791-6 s 2\p DE-604 Buchanan, Brett 1975- (DE-588)13793159X trl Latour, Bruno 1947-2022 (DE-588)119404923 wpr Posthumanities 38 (DE-604)BV022621177 38 Digitalisierung UB Augsburg - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029137458&sequence=000003&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis Digitalisierung UB Augsburg - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029137458&sequence=000004&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA Klappentext 1\p cgwrk 20201028 DE-101 https://d-nb.info/provenance/plan#cgwrk 2\p cgwrk 20201028 DE-101 https://d-nb.info/provenance/plan#cgwrk |
spellingShingle | Despret, Vinciane 1959- What would animals say if we asked the right questions? Posthumanities Animal behavior Miscellanea Philosophie (DE-588)4045791-6 gnd Tiere (DE-588)4060087-7 gnd Tierpsychologie (DE-588)4185497-4 gnd Verhalten (DE-588)4062860-7 gnd |
subject_GND | (DE-588)4045791-6 (DE-588)4060087-7 (DE-588)4185497-4 (DE-588)4062860-7 |
title | What would animals say if we asked the right questions? |
title_alt | Que diraient les animaux, si... on leur posait les bonnes questions? |
title_auth | What would animals say if we asked the right questions? |
title_exact_search | What would animals say if we asked the right questions? |
title_full | What would animals say if we asked the right questions? Vinciane Despret ; translated by Brett Buchanan ; foreword by Bruno Latour |
title_fullStr | What would animals say if we asked the right questions? Vinciane Despret ; translated by Brett Buchanan ; foreword by Bruno Latour |
title_full_unstemmed | What would animals say if we asked the right questions? Vinciane Despret ; translated by Brett Buchanan ; foreword by Bruno Latour |
title_short | What would animals say if we asked the right questions? |
title_sort | what would animals say if we asked the right questions |
topic | Animal behavior Miscellanea Philosophie (DE-588)4045791-6 gnd Tiere (DE-588)4060087-7 gnd Tierpsychologie (DE-588)4185497-4 gnd Verhalten (DE-588)4062860-7 gnd |
topic_facet | Animal behavior Miscellanea Philosophie Tiere Tierpsychologie Verhalten |
url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029137458&sequence=000003&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029137458&sequence=000004&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |
volume_link | (DE-604)BV022621177 |
work_keys_str_mv | AT despretvinciane quediraientlesanimauxsionleurposaitlesbonnesquestions AT buchananbrett quediraientlesanimauxsionleurposaitlesbonnesquestions AT latourbruno quediraientlesanimauxsionleurposaitlesbonnesquestions AT despretvinciane whatwouldanimalssayifweaskedtherightquestions AT buchananbrett whatwouldanimalssayifweaskedtherightquestions AT latourbruno whatwouldanimalssayifweaskedtherightquestions |