A Commentary on T.S. Eliot's Poem The Waste Land: the Infertility Theme and the Poet's Unhappy Marriage
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Elektronisch E-Book |
| Sprache: | English |
| Veröffentlicht: |
Lewiston
Edwin Mellen Press
2001
|
| Schlagworte: | |
| Online-Zugang: | FAW01 FAW02 Volltext |
| Beschreibung: | Print version record |
| Beschreibung: | 1 online resource (226 pages) |
| ISBN: | 0773411739 9780773411739 |
Internformat
MARC
| LEADER | 00000nmm a2200000zc 4500 | ||
|---|---|---|---|
| 001 | BV043036559 | ||
| 003 | DE-604 | ||
| 005 | 00000000000000.0 | ||
| 007 | cr|uuu---uuuuu | ||
| 008 | 151120s2001 |||| o||u| ||||||eng d | ||
| 020 | |a 0773411739 |c electronic bk. |9 0-7734-1173-9 | ||
| 020 | |a 9780773411739 |c electronic bk. |9 978-0-7734-1173-9 | ||
| 035 | |a (OCoLC)797915742 | ||
| 035 | |a (DE-599)BVBBV043036559 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-1046 |a DE-1047 | ||
| 082 | 0 | |a 821.912 | |
| 082 | 0 | |a 821/.912 | |
| 100 | 1 | |a Claes, Paul |e Verfasser |4 aut | |
| 245 | 1 | 0 | |a A Commentary on T.S. Eliot's Poem The Waste Land |b the Infertility Theme and the Poet's Unhappy Marriage |
| 264 | 1 | |a Lewiston |b Edwin Mellen Press |c 2001 | |
| 300 | |a 1 online resource (226 pages) | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b c |2 rdamedia | ||
| 338 | |b cr |2 rdacarrier | ||
| 500 | |a Print version record | ||
| 505 | 8 | |a Title Page; Copyright; Abstract; Contents; Foreword; Preface; Introduction; I. Historical Context; II. The Making of the Poem; III. Mythical Substrate; IV. The Modernist Form; V. Six Keys of Interpretation; VI. A New Reading; Commentary; Preliminary Note; Textual Corrections; I. The Burial of the Dead; II. A Game of Chess; III. The Fire Sermon; IV. Death by Water; V. What the Thunder Said; The Biographical Key; I. The Biographical Approach; II. Autobiographical Allusions; III. An Elegy?; IV. The Love Triangle; V.A Biographical Reading; Coda; Bibliography | |
| 505 | 8 | |a Claes argues that The Waste Land by T.S. Eliot is actually indicative of infertility in his marriage. While also cracking several riddles that Eliot put into the poem, this book provides ample evidence that the work is auto-biographical in nature. Claes provides line-by-line analysis of the poem, and the introduction presents six interpretive keys facilitating a systematic decoding. Textual arrangement, thematic recurrence, metaphorical syncretism, mythical method, allegorical representation, and inter-textual reference may help the reader to penetrate the multiple mysteries of the poem | |
| 600 | 1 | 4 | |a Eliot, T. S. |q (Thomas Stearns) |d 1888-1965 |t Waste land |
| 600 | 1 | 7 | |a Eliot, T. S. |d 1888-1965 |t The waste land |0 (DE-588)4201261-2 |2 gnd |9 rswk-swf |
| 650 | 4 | |a Eliot, T.S. (Thomas Stearns), 1888-1965. Waste land | |
| 650 | 4 | |a Literature | |
| 650 | 7 | |a POETRY / English, Irish, Scottish, Welsh |2 bisacsh | |
| 650 | 7 | |a Waste land (Eliot, T.S.) |2 fast | |
| 650 | 4 | |a Literatur | |
| 655 | 7 | |8 1\p |0 (DE-588)4136710-8 |a Kommentar |2 gnd-content | |
| 689 | 0 | 0 | |a Eliot, T. S. |d 1888-1965 |t The waste land |0 (DE-588)4201261-2 |D u |
| 689 | 0 | |8 2\p |5 DE-604 | |
| 776 | 0 | 8 | |i Erscheint auch als |n Druck-Ausgabe |a Claes, Paul |t A Commentary on T.S. Eliot's Poem The Waste Land : The Infertility Theme and the Poet's Unhappy Marriage |
| 856 | 4 | 0 | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&db=nlabk&AN=467279 |x Aggregator |3 Volltext |
| 912 | |a ZDB-4-EBA | ||
| 999 | |a oai:aleph.bib-bvb.de:BVB01-028461208 | ||
| 883 | 1 | |8 1\p |a cgwrk |d 20201028 |q DE-101 |u https://d-nb.info/provenance/plan#cgwrk | |
| 883 | 1 | |8 2\p |a cgwrk |d 20201028 |q DE-101 |u https://d-nb.info/provenance/plan#cgwrk | |
| 966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&db=nlabk&AN=467279 |l FAW01 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext | |
| 966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&db=nlabk&AN=467279 |l FAW02 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext | |
Datensatz im Suchindex
| _version_ | 1804175397227593728 |
|---|---|
| any_adam_object | |
| author | Claes, Paul |
| author_facet | Claes, Paul |
| author_role | aut |
| author_sort | Claes, Paul |
| author_variant | p c pc |
| building | Verbundindex |
| bvnumber | BV043036559 |
| collection | ZDB-4-EBA |
| contents | Title Page; Copyright; Abstract; Contents; Foreword; Preface; Introduction; I. Historical Context; II. The Making of the Poem; III. Mythical Substrate; IV. The Modernist Form; V. Six Keys of Interpretation; VI. A New Reading; Commentary; Preliminary Note; Textual Corrections; I. The Burial of the Dead; II. A Game of Chess; III. The Fire Sermon; IV. Death by Water; V. What the Thunder Said; The Biographical Key; I. The Biographical Approach; II. Autobiographical Allusions; III. An Elegy?; IV. The Love Triangle; V.A Biographical Reading; Coda; Bibliography Claes argues that The Waste Land by T.S. Eliot is actually indicative of infertility in his marriage. While also cracking several riddles that Eliot put into the poem, this book provides ample evidence that the work is auto-biographical in nature. Claes provides line-by-line analysis of the poem, and the introduction presents six interpretive keys facilitating a systematic decoding. Textual arrangement, thematic recurrence, metaphorical syncretism, mythical method, allegorical representation, and inter-textual reference may help the reader to penetrate the multiple mysteries of the poem |
| ctrlnum | (OCoLC)797915742 (DE-599)BVBBV043036559 |
| dewey-full | 821.912 821/.912 |
| dewey-hundreds | 800 - Literature (Belles-lettres) and rhetoric |
| dewey-ones | 821 - English poetry |
| dewey-raw | 821.912 821/.912 |
| dewey-search | 821.912 821/.912 |
| dewey-sort | 3821.912 |
| dewey-tens | 820 - English & Old English literatures |
| discipline | Anglistik / Amerikanistik |
| format | Electronic eBook |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>03525nmm a2200529zc 4500</leader><controlfield tag="001">BV043036559</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">00000000000000.0</controlfield><controlfield tag="007">cr|uuu---uuuuu</controlfield><controlfield tag="008">151120s2001 |||| o||u| ||||||eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">0773411739</subfield><subfield code="c">electronic bk.</subfield><subfield code="9">0-7734-1173-9</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9780773411739</subfield><subfield code="c">electronic bk.</subfield><subfield code="9">978-0-7734-1173-9</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)797915742</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV043036559</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-1046</subfield><subfield code="a">DE-1047</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">821.912</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">821/.912</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Claes, Paul</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">A Commentary on T.S. Eliot's Poem The Waste Land</subfield><subfield code="b">the Infertility Theme and the Poet's Unhappy Marriage</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Lewiston</subfield><subfield code="b">Edwin Mellen Press</subfield><subfield code="c">2001</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (226 pages)</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Print version record</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Title Page; Copyright; Abstract; Contents; Foreword; Preface; Introduction; I. Historical Context; II. The Making of the Poem; III. Mythical Substrate; IV. The Modernist Form; V. Six Keys of Interpretation; VI. A New Reading; Commentary; Preliminary Note; Textual Corrections; I. The Burial of the Dead; II. A Game of Chess; III. The Fire Sermon; IV. Death by Water; V. What the Thunder Said; The Biographical Key; I. The Biographical Approach; II. Autobiographical Allusions; III. An Elegy?; IV. The Love Triangle; V.A Biographical Reading; Coda; Bibliography</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Claes argues that The Waste Land by T.S. Eliot is actually indicative of infertility in his marriage. While also cracking several riddles that Eliot put into the poem, this book provides ample evidence that the work is auto-biographical in nature. Claes provides line-by-line analysis of the poem, and the introduction presents six interpretive keys facilitating a systematic decoding. Textual arrangement, thematic recurrence, metaphorical syncretism, mythical method, allegorical representation, and inter-textual reference may help the reader to penetrate the multiple mysteries of the poem</subfield></datafield><datafield tag="600" ind1="1" ind2="4"><subfield code="a">Eliot, T. S.</subfield><subfield code="q">(Thomas Stearns)</subfield><subfield code="d">1888-1965</subfield><subfield code="t">Waste land</subfield></datafield><datafield tag="600" ind1="1" ind2="7"><subfield code="a">Eliot, T. S.</subfield><subfield code="d">1888-1965</subfield><subfield code="t">The waste land</subfield><subfield code="0">(DE-588)4201261-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Eliot, T.S. (Thomas Stearns), 1888-1965. Waste land</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Literature</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">POETRY / English, Irish, Scottish, Welsh</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Waste land (Eliot, T.S.)</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Literatur</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="8">1\p</subfield><subfield code="0">(DE-588)4136710-8</subfield><subfield code="a">Kommentar</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Eliot, T. S.</subfield><subfield code="d">1888-1965</subfield><subfield code="t">The waste land</subfield><subfield code="0">(DE-588)4201261-2</subfield><subfield code="D">u</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="8">2\p</subfield><subfield code="5">DE-604</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Druck-Ausgabe</subfield><subfield code="a">Claes, Paul</subfield><subfield code="t">A Commentary on T.S. Eliot's Poem The Waste Land : The Infertility Theme and the Poet's Unhappy Marriage</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&db=nlabk&AN=467279</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-028461208</subfield></datafield><datafield tag="883" ind1="1" ind2=" "><subfield code="8">1\p</subfield><subfield code="a">cgwrk</subfield><subfield code="d">20201028</subfield><subfield code="q">DE-101</subfield><subfield code="u">https://d-nb.info/provenance/plan#cgwrk</subfield></datafield><datafield tag="883" ind1="1" ind2=" "><subfield code="8">2\p</subfield><subfield code="a">cgwrk</subfield><subfield code="d">20201028</subfield><subfield code="q">DE-101</subfield><subfield code="u">https://d-nb.info/provenance/plan#cgwrk</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&db=nlabk&AN=467279</subfield><subfield code="l">FAW01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&db=nlabk&AN=467279</subfield><subfield code="l">FAW02</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield></record></collection> |
| genre | 1\p (DE-588)4136710-8 Kommentar gnd-content |
| genre_facet | Kommentar |
| id | DE-604.BV043036559 |
| illustrated | Not Illustrated |
| indexdate | 2024-07-10T07:15:38Z |
| institution | BVB |
| isbn | 0773411739 9780773411739 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-028461208 |
| oclc_num | 797915742 |
| open_access_boolean | |
| owner | DE-1046 DE-1047 |
| owner_facet | DE-1046 DE-1047 |
| physical | 1 online resource (226 pages) |
| psigel | ZDB-4-EBA ZDB-4-EBA FAW_PDA_EBA |
| publishDate | 2001 |
| publishDateSearch | 2001 |
| publishDateSort | 2001 |
| publisher | Edwin Mellen Press |
| record_format | marc |
| spelling | Claes, Paul Verfasser aut A Commentary on T.S. Eliot's Poem The Waste Land the Infertility Theme and the Poet's Unhappy Marriage Lewiston Edwin Mellen Press 2001 1 online resource (226 pages) txt rdacontent c rdamedia cr rdacarrier Print version record Title Page; Copyright; Abstract; Contents; Foreword; Preface; Introduction; I. Historical Context; II. The Making of the Poem; III. Mythical Substrate; IV. The Modernist Form; V. Six Keys of Interpretation; VI. A New Reading; Commentary; Preliminary Note; Textual Corrections; I. The Burial of the Dead; II. A Game of Chess; III. The Fire Sermon; IV. Death by Water; V. What the Thunder Said; The Biographical Key; I. The Biographical Approach; II. Autobiographical Allusions; III. An Elegy?; IV. The Love Triangle; V.A Biographical Reading; Coda; Bibliography Claes argues that The Waste Land by T.S. Eliot is actually indicative of infertility in his marriage. While also cracking several riddles that Eliot put into the poem, this book provides ample evidence that the work is auto-biographical in nature. Claes provides line-by-line analysis of the poem, and the introduction presents six interpretive keys facilitating a systematic decoding. Textual arrangement, thematic recurrence, metaphorical syncretism, mythical method, allegorical representation, and inter-textual reference may help the reader to penetrate the multiple mysteries of the poem Eliot, T. S. (Thomas Stearns) 1888-1965 Waste land Eliot, T. S. 1888-1965 The waste land (DE-588)4201261-2 gnd rswk-swf Eliot, T.S. (Thomas Stearns), 1888-1965. Waste land Literature POETRY / English, Irish, Scottish, Welsh bisacsh Waste land (Eliot, T.S.) fast Literatur 1\p (DE-588)4136710-8 Kommentar gnd-content Eliot, T. S. 1888-1965 The waste land (DE-588)4201261-2 u 2\p DE-604 Erscheint auch als Druck-Ausgabe Claes, Paul A Commentary on T.S. Eliot's Poem The Waste Land : The Infertility Theme and the Poet's Unhappy Marriage http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&db=nlabk&AN=467279 Aggregator Volltext 1\p cgwrk 20201028 DE-101 https://d-nb.info/provenance/plan#cgwrk 2\p cgwrk 20201028 DE-101 https://d-nb.info/provenance/plan#cgwrk |
| spellingShingle | Claes, Paul A Commentary on T.S. Eliot's Poem The Waste Land the Infertility Theme and the Poet's Unhappy Marriage Title Page; Copyright; Abstract; Contents; Foreword; Preface; Introduction; I. Historical Context; II. The Making of the Poem; III. Mythical Substrate; IV. The Modernist Form; V. Six Keys of Interpretation; VI. A New Reading; Commentary; Preliminary Note; Textual Corrections; I. The Burial of the Dead; II. A Game of Chess; III. The Fire Sermon; IV. Death by Water; V. What the Thunder Said; The Biographical Key; I. The Biographical Approach; II. Autobiographical Allusions; III. An Elegy?; IV. The Love Triangle; V.A Biographical Reading; Coda; Bibliography Claes argues that The Waste Land by T.S. Eliot is actually indicative of infertility in his marriage. While also cracking several riddles that Eliot put into the poem, this book provides ample evidence that the work is auto-biographical in nature. Claes provides line-by-line analysis of the poem, and the introduction presents six interpretive keys facilitating a systematic decoding. Textual arrangement, thematic recurrence, metaphorical syncretism, mythical method, allegorical representation, and inter-textual reference may help the reader to penetrate the multiple mysteries of the poem Eliot, T. S. (Thomas Stearns) 1888-1965 Waste land Eliot, T. S. 1888-1965 The waste land (DE-588)4201261-2 gnd Eliot, T.S. (Thomas Stearns), 1888-1965. Waste land Literature POETRY / English, Irish, Scottish, Welsh bisacsh Waste land (Eliot, T.S.) fast Literatur |
| subject_GND | (DE-588)4201261-2 (DE-588)4136710-8 |
| title | A Commentary on T.S. Eliot's Poem The Waste Land the Infertility Theme and the Poet's Unhappy Marriage |
| title_auth | A Commentary on T.S. Eliot's Poem The Waste Land the Infertility Theme and the Poet's Unhappy Marriage |
| title_exact_search | A Commentary on T.S. Eliot's Poem The Waste Land the Infertility Theme and the Poet's Unhappy Marriage |
| title_full | A Commentary on T.S. Eliot's Poem The Waste Land the Infertility Theme and the Poet's Unhappy Marriage |
| title_fullStr | A Commentary on T.S. Eliot's Poem The Waste Land the Infertility Theme and the Poet's Unhappy Marriage |
| title_full_unstemmed | A Commentary on T.S. Eliot's Poem The Waste Land the Infertility Theme and the Poet's Unhappy Marriage |
| title_short | A Commentary on T.S. Eliot's Poem The Waste Land |
| title_sort | a commentary on t s eliot s poem the waste land the infertility theme and the poet s unhappy marriage |
| title_sub | the Infertility Theme and the Poet's Unhappy Marriage |
| topic | Eliot, T. S. (Thomas Stearns) 1888-1965 Waste land Eliot, T. S. 1888-1965 The waste land (DE-588)4201261-2 gnd Eliot, T.S. (Thomas Stearns), 1888-1965. Waste land Literature POETRY / English, Irish, Scottish, Welsh bisacsh Waste land (Eliot, T.S.) fast Literatur |
| topic_facet | Eliot, T. S. (Thomas Stearns) 1888-1965 Waste land Eliot, T. S. 1888-1965 The waste land Eliot, T.S. (Thomas Stearns), 1888-1965. Waste land Literature POETRY / English, Irish, Scottish, Welsh Waste land (Eliot, T.S.) Literatur Kommentar |
| url | http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&db=nlabk&AN=467279 |
| work_keys_str_mv | AT claespaul acommentaryontseliotspoemthewastelandtheinfertilitythemeandthepoetsunhappymarriage |