Social media and election campaigns: key tendencies and ways forward
Gespeichert in:
| Weitere Verfasser: | , |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
London
Routledge, Taylor & Francis Group
2015
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | "The chapters in this book were originally published in Information, Communication & Society, volume 16, issue 5 (June 2013)." first issued in paperback 2017 |
| Beschreibung: | xi, 195 Seiten Diagramme |
| ISBN: | 9781138930469 9781138085350 |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV042638322 | ||
| 003 | DE-604 | ||
| 005 | 20170726 | ||
| 007 | t | ||
| 008 | 150624s2015 |||| |||| 00||| eng d | ||
| 020 | |a 9781138930469 |c hbk |9 978-1-138-93046-9 | ||
| 020 | |a 9781138085350 |c pbk |9 978-1-138-08535-0 | ||
| 035 | |a (OCoLC)913889795 | ||
| 035 | |a (DE-599)BVBBV042638322 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-473 |a DE-384 |a DE-739 | ||
| 084 | |a AP 15950 |0 (DE-625)6960: |2 rvk | ||
| 084 | |a MF 4700 |0 (DE-625)122726: |2 rvk | ||
| 245 | 1 | 0 | |a Social media and election campaigns |b key tendencies and ways forward |c edited by Gunn Enli and Hallvard Moe |
| 264 | 1 | |a London |b Routledge, Taylor & Francis Group |c 2015 | |
| 300 | |a xi, 195 Seiten |b Diagramme | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 500 | |a "The chapters in this book were originally published in Information, Communication & Society, volume 16, issue 5 (June 2013)." | ||
| 500 | |a first issued in paperback 2017 | ||
| 650 | 0 | 7 | |a Social Media |0 (DE-588)4639271-3 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Wahlkampf |0 (DE-588)4064292-6 |2 gnd |9 rswk-swf |
| 655 | 7 | |0 (DE-588)4143413-4 |a Aufsatzsammlung |2 gnd-content | |
| 689 | 0 | 0 | |a Wahlkampf |0 (DE-588)4064292-6 |D s |
| 689 | 0 | 1 | |a Social Media |0 (DE-588)4639271-3 |D s |
| 689 | 0 | |5 DE-604 | |
| 700 | 1 | |a Enli, Gunn |d 1970- |0 (DE-588)1084353687 |4 edt | |
| 700 | 1 | |a Moe, Hallvard |d 1977- |0 (DE-588)108435585X |4 edt | |
| 856 | 4 | 2 | |m Digitalisierung UB Bamberg - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=028070756&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-028070756 | ||
Datensatz im Suchindex
| _version_ | 1804174821138890752 |
|---|---|
| adam_text | Contents
Citation Information vii
Notes on Contributors ix
Introduction: Social media and election campaigns — key tendencies and
ways forward 1
Gunn Enli and Hallvard Moe
1. Wave-riding and hash tag-jumping: Twitter, minority Third parties’ and
the 2012 US elections 10
Christian Christensen
2. Political networks on Twitter: Tweeting the Queensland state election 31
Axel Bruns and Tim Highjield
3. Between broadcasting political messages and interacting with voters:
The use of Twitter during the 2010 UK general election campaign 56
Todd Graham, Marcel Broersma, Karin Hazelhoff and Guido van ’t Haar
4. Mastering the art of social media: Swiss parties, the 2011 national
election and digital challenges 80
Ulrike Klinger
5. Dodging the gatekeepers?: Social media in the campaign mix during the
2011 Danish elections 99
Morten Skovsgaard and Arjen Van Dalen
6. Personalized campaigns in party-centred politics: Twitter and Facebook
as arenas for political communication 119
Gunn Sara Enli and Eli Skogerbo
1. Untangling a complex media system: A comparative study of Twitter-
linking practices during three Scandinavian election campaigns 1 36
Hallvard Moe and Anders Olof Larsson
v
CONTENTS
8. An investigation of influentials and the role of sentiment in political
communication on Twitter during election periods
Linh Dang-Xuan, Stefan Stieglitz, Jennifer Wladarsch and Christoph Neuberger
Index
vi
156
187
|
| any_adam_object | 1 |
| author2 | Enli, Gunn 1970- Moe, Hallvard 1977- |
| author2_role | edt edt |
| author2_variant | g e ge h m hm |
| author_GND | (DE-588)1084353687 (DE-588)108435585X |
| author_facet | Enli, Gunn 1970- Moe, Hallvard 1977- |
| building | Verbundindex |
| bvnumber | BV042638322 |
| classification_rvk | AP 15950 MF 4700 |
| ctrlnum | (OCoLC)913889795 (DE-599)BVBBV042638322 |
| discipline | Allgemeines Politologie |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01802nam a2200409 c 4500</leader><controlfield tag="001">BV042638322</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20170726 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">150624s2015 |||| |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781138930469</subfield><subfield code="c">hbk</subfield><subfield code="9">978-1-138-93046-9</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781138085350</subfield><subfield code="c">pbk</subfield><subfield code="9">978-1-138-08535-0</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)913889795</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV042638322</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-473</subfield><subfield code="a">DE-384</subfield><subfield code="a">DE-739</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">AP 15950</subfield><subfield code="0">(DE-625)6960:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">MF 4700</subfield><subfield code="0">(DE-625)122726:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Social media and election campaigns</subfield><subfield code="b">key tendencies and ways forward</subfield><subfield code="c">edited by Gunn Enli and Hallvard Moe</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">London</subfield><subfield code="b">Routledge, Taylor & Francis Group</subfield><subfield code="c">2015</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">xi, 195 Seiten</subfield><subfield code="b">Diagramme</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">"The chapters in this book were originally published in Information, Communication & Society, volume 16, issue 5 (June 2013)."</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">first issued in paperback 2017</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Social Media</subfield><subfield code="0">(DE-588)4639271-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Wahlkampf</subfield><subfield code="0">(DE-588)4064292-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)4143413-4</subfield><subfield code="a">Aufsatzsammlung</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Wahlkampf</subfield><subfield code="0">(DE-588)4064292-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Social Media</subfield><subfield code="0">(DE-588)4639271-3</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Enli, Gunn</subfield><subfield code="d">1970-</subfield><subfield code="0">(DE-588)1084353687</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Moe, Hallvard</subfield><subfield code="d">1977-</subfield><subfield code="0">(DE-588)108435585X</subfield><subfield code="4">edt</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Bamberg - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=028070756&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-028070756</subfield></datafield></record></collection> |
| genre | (DE-588)4143413-4 Aufsatzsammlung gnd-content |
| genre_facet | Aufsatzsammlung |
| id | DE-604.BV042638322 |
| illustrated | Not Illustrated |
| indexdate | 2024-07-10T07:06:29Z |
| institution | BVB |
| isbn | 9781138930469 9781138085350 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-028070756 |
| oclc_num | 913889795 |
| open_access_boolean | |
| owner | DE-473 DE-BY-UBG DE-384 DE-739 |
| owner_facet | DE-473 DE-BY-UBG DE-384 DE-739 |
| physical | xi, 195 Seiten Diagramme |
| publishDate | 2015 |
| publishDateSearch | 2015 |
| publishDateSort | 2015 |
| publisher | Routledge, Taylor & Francis Group |
| record_format | marc |
| spelling | Social media and election campaigns key tendencies and ways forward edited by Gunn Enli and Hallvard Moe London Routledge, Taylor & Francis Group 2015 xi, 195 Seiten Diagramme txt rdacontent n rdamedia nc rdacarrier "The chapters in this book were originally published in Information, Communication & Society, volume 16, issue 5 (June 2013)." first issued in paperback 2017 Social Media (DE-588)4639271-3 gnd rswk-swf Wahlkampf (DE-588)4064292-6 gnd rswk-swf (DE-588)4143413-4 Aufsatzsammlung gnd-content Wahlkampf (DE-588)4064292-6 s Social Media (DE-588)4639271-3 s DE-604 Enli, Gunn 1970- (DE-588)1084353687 edt Moe, Hallvard 1977- (DE-588)108435585X edt Digitalisierung UB Bamberg - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=028070756&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Social media and election campaigns key tendencies and ways forward Social Media (DE-588)4639271-3 gnd Wahlkampf (DE-588)4064292-6 gnd |
| subject_GND | (DE-588)4639271-3 (DE-588)4064292-6 (DE-588)4143413-4 |
| title | Social media and election campaigns key tendencies and ways forward |
| title_auth | Social media and election campaigns key tendencies and ways forward |
| title_exact_search | Social media and election campaigns key tendencies and ways forward |
| title_full | Social media and election campaigns key tendencies and ways forward edited by Gunn Enli and Hallvard Moe |
| title_fullStr | Social media and election campaigns key tendencies and ways forward edited by Gunn Enli and Hallvard Moe |
| title_full_unstemmed | Social media and election campaigns key tendencies and ways forward edited by Gunn Enli and Hallvard Moe |
| title_short | Social media and election campaigns |
| title_sort | social media and election campaigns key tendencies and ways forward |
| title_sub | key tendencies and ways forward |
| topic | Social Media (DE-588)4639271-3 gnd Wahlkampf (DE-588)4064292-6 gnd |
| topic_facet | Social Media Wahlkampf Aufsatzsammlung |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=028070756&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT enligunn socialmediaandelectioncampaignskeytendenciesandwaysforward AT moehallvard socialmediaandelectioncampaignskeytendenciesandwaysforward |