Shqiptar dhe shqa: histori popujsh përmes dy emrave etnikë : (triptik etnolinguistik)
Gespeichert in:
1. Verfasser: | |
---|---|
Format: | Buch |
Sprache: | Albanian |
Veröffentlicht: |
Tiranë
Naimi
2014
|
Schlagworte: | |
Online-Zugang: | Inhaltsverzeichnis Literaturverzeichnis Register // Personenregister |
Beschreibung: | 248 Seiten Illustrationen, Karten |
ISBN: | 9789928109750 |
Internformat
MARC
LEADER | 00000nam a2200000 c 4500 | ||
---|---|---|---|
001 | BV042392322 | ||
003 | DE-604 | ||
005 | 20171011 | ||
007 | t | ||
008 | 150305s2014 a||| |||| 00||| alb d | ||
020 | |a 9789928109750 |9 978-9928-109-75-0 | ||
035 | |a (OCoLC)904437044 | ||
035 | |a (DE-599)BVBBV042392322 | ||
040 | |a DE-604 |b ger |e rda | ||
041 | 0 | |a alb | |
049 | |a DE-19 |a DE-12 | ||
084 | |a OST |q DE-12 |2 fid | ||
100 | 1 | |a Demiraj, Bardhyl |d 1958- |e Verfasser |0 (DE-588)120015935 |4 aut | |
245 | 1 | 0 | |a Shqiptar dhe shqa |b histori popujsh përmes dy emrave etnikë : (triptik etnolinguistik) |c Bardhyl Demiraj |
264 | 1 | |a Tiranë |b Naimi |c 2014 | |
300 | |a 248 Seiten |b Illustrationen, Karten | ||
336 | |b txt |2 rdacontent | ||
337 | |b n |2 rdamedia | ||
338 | |b nc |2 rdacarrier | ||
648 | 7 | |a Sozialgeschichte 500-1050 |2 gnd |9 rswk-swf | |
648 | 7 | |a Geschichte |2 gnd |9 rswk-swf | |
650 | 0 | 7 | |a Albaner |0 (DE-588)4068517-2 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Albanisch |0 (DE-588)4112482-0 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Kulturkontakt |0 (DE-588)4033569-0 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Exonym |0 (DE-588)4632516-5 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Shqiptar |g Wort |0 (DE-588)7825934-4 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Nachbarvolk |0 (DE-588)4299286-2 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Shqa |g Wort |0 (DE-588)1141245965 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Ethnographischer Name |0 (DE-588)4273620-1 |2 gnd |9 rswk-swf |
689 | 0 | 0 | |a Albanisch |0 (DE-588)4112482-0 |D s |
689 | 0 | 1 | |a Ethnographischer Name |0 (DE-588)4273620-1 |D s |
689 | 0 | 2 | |a Shqiptar |g Wort |0 (DE-588)7825934-4 |D s |
689 | 0 | 3 | |a Exonym |0 (DE-588)4632516-5 |D s |
689 | 0 | 4 | |a Shqa |g Wort |0 (DE-588)1141245965 |D s |
689 | 0 | 5 | |a Geschichte |A z |
689 | 0 | |5 DE-604 | |
689 | 1 | 0 | |a Albaner |0 (DE-588)4068517-2 |D s |
689 | 1 | 1 | |a Nachbarvolk |0 (DE-588)4299286-2 |D s |
689 | 1 | 2 | |a Kulturkontakt |0 (DE-588)4033569-0 |D s |
689 | 1 | 3 | |a Sozialgeschichte 500-1050 |A z |
689 | 1 | |5 DE-604 | |
856 | 4 | 2 | |m Digitalisierung BSB Muenchen 24 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027828184&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
856 | 4 | 2 | |m Digitalisierung BSB Muenchen 24 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027828184&sequence=000002&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |3 Literaturverzeichnis |
856 | 4 | 2 | |m Digitalisierung BSB Muenchen 24 - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027828184&sequence=000003&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA |3 Register // Personenregister |
940 | 1 | |n oe | |
999 | |a oai:aleph.bib-bvb.de:BVB01-027828184 | ||
942 | 1 | 1 | |c 306.09 |e 22/bsb |f 09021 |g 496 |
942 | 1 | 1 | |c 417.7 |e 22/bsb |g 4965 |
942 | 1 | 1 | |c 306.09 |e 22/bsb |f 09021 |g 4965 |
Datensatz im Suchindex
_version_ | 1804153042154553344 |
---|---|
adam_text | LENDA
Vėzhgime hyrėse:
Çeshtja shqiptare ne debatin
intelektual-albanologjik........................11
I. Emri etnik shqiptar.
Pėrhapja dhe pėrgjithėsimi i tij nė shek. XVIII.... 55
Dy fjalė......................................57
1. Tipare te pėrbashkėta dhe dalluese
nė studimet e derisotme.........................60
2. Dokumentimi i etnonimit shqiptar
nė shek. XVm....................................67
Dėshmi te mėhershme: Schipudar
(?) Tam. Shqipfolesi (1368-1402)..............82
3. Shqyrtim gjuhėsor-historik i etnonimit shqiptar. 90
4. Vėshtrim etnolinguistik i etnonimit shqiptar....102
a. Kur ka ndodhur ndėrrimi i etnikėve?.........105
b. Perse u mėnjanua nga pėrdorimi kompleksi
etnonimik *arbėn/r(-) ndėr shqiptare? .......110
5. Pėrfundim......................................128
6. Shtojcė........................................128
6.1. Çerdhja leksikore e bazės shqip(-)
nė shqipen e fillimit te shek. XVIII...........134
8
Lenda
6.2 Zhvendosjet semantike te shenjuesit *shqipetar
pergjate shek. XVIII..........................138
6.3. /qi vjen me thashune shqip/ (Buzuku 1555)...143
II. shqau nder shqiptare
֊ rast studimi etnolinguistik.................157
1. Qerthulli problematik dhe diskutimi
perkates......................................159
2. Shtrirja dialektore, perdorimi dhe ^erdhja
leksikore perkatese...........................163
2.1. Gjendja gjuhesore ne hapesiren
kompakte shqipfolese..........................163
2.1.1. Vendi i vegante i arealit dialektor
te toskerishtes jugore........................172
2.2. Gjendja ne diasporen historike shqiptare...173
2.2.1. Pozicioni i vegante i enklavave shqiptare
ne Greqi dhe ne Italine e Jugut...............175
2.3. (^erdhja leksikore e fjales.................177
3. Shqa ne fokusin e etimologjise dhe
te etnolinguistikes...........................180
3.1. Origjina: huazim nga greqishtja
bizantine apo latinishtja e mesme?............180
3.2. Shnderrime kuptimore........................183
3.3. Shqa ne fokusin e historise se
brendshme te fjales...........................186
4. Perfundim.....................................196
Lenda
9
III. Dy popuj ne kontakt
trevat shąiptare ne mesjeten e hershme........199
1. Qerthulli tematik dhe diskutimi perkates.....201
2. Premisa metodike........................... 205
2.1. Areale kulturore-gjeografike vs. areale
gjuhesore etnike..............................205
2.2. Ndikimi i greąishtes se vjetėr —
nje barriere psikologjike.....................207
2.3. Marrėdheniet e filiacionit se shąipes
me nje gjuhe te Ballkanit antik...............207
2.4. Rruga e trete..............................209
3. Ndarja dialektore e hapesires kompakte
shąipfolese ne shek. V/VI - IX e.j............211
3.1. Jugu i Shqiperise - pjese perberese
e hapesires kompakte shqipfolėse ne
mesjeten e hershme............................213
3.2. Veriu i Shqiperise - pjese perberese
e hapesires kompakte shqipfolese ne
mesjeten e hershme............................218
3.3. Krahina e Matit - nje zone relikte e
shqiptareve ne mesjeten e hershme (?).........220
4. Perfundim....................................224
Treguesi i emrave...............................225
Bibliografi.....................................229
Bibliografi
I. Literature shkencore e cituar
Altimari, F.: Alcuni etnici di origine albanese nei
dialetti di Calabria, ne: Scripta minora
albanica , ne serine: Quademi di Zjarri ,
Rende 1994 (1992), f. 47-57.
Arapi, L: Der Gebrauch von Infinitiv und Konjunktiv
im Altalbanischen mit Ausblick auf das
Rumänische. Hamburg 2010.
ASHTA, K.: Leksiku historik i gjuhes shqipe, bl. III,
Shkoder 2000.
Bartl, P.: Die Albanischen Muslime zur Zeit der na-
tionalen Unabhängigkeitsbewegung, Wies-
baden 1968.
Bartl, P.: Albanien. Vom Mittelalter bis zur Gegen-
wart, Regensburg 1995.
Buda, A.: Etnogjeneza e popullit shqiptar ne driten e
historise, ne: Konferenca Kombetare per
formimin e popullit shqiptar, te gjuhes
dhe te kultures se tij (Tirane, 2-5 korrik
1982), Tirane 1988, f. 15-31.
230
Bibliografi
CHETTA, N. (= Nikollè Keta): Lessico italiano-albane-
se del sac. (1763 — dorèshkrim: mikrofilmi
ndodhet né bibliotekèn e universitetit té
Kalabrisé nè: Fondo Gangale : Theca III. 29)
Chetta, N: Tesoro di notizie su de Macedoni (Paler-
mo 1777 — dsh; Ed. critica a cura di Matteo
Mandala Giuseppa Fucarino), Contessa
Entellina 2002.
CURTA, F.: The Making of thè Slavs. History and
Archaeology of thè Lower Danube Re-
gion, c. 500—700. Cambridge 2001.
C^ABEJ, E: emrat nacionale té shqiptarève, nè: Studi-
me Gjuhèsore , Bleu V, Prishtiné 1975
(1972) 68-71.
C^ABEJ, E.: Emri i vjetér nacional i shqiptarève, nè:
Studime Gjuhèsore , Bleu V, Prishtiné
1975, 63-67.
C^ABEJ, E. Xhuvani, Aleksander: Prapashtesat e
gjuhès shqipe, ne: Studime Gjuhèsore ,
bleu III, Prishtiné 1976 (botimi i pare
1962), f. 191 - 303.
C^abej, E.: Studime etimologjike né fushé té shqipes,
Bleu II, Tirane 1976.
Demiraj, B.: Pèrkime dhe paralelizma fonetike dhe
gramatikore midis shqipes dhe rumani-
Bibliografi
231
shtes sipas punimeve te autoreve shqip-
tare dhe rumune. Tirane 1982 (punim dip-
lome - 124 f. drsh.).
Demiraj, B.: Sistemi i numerimit te gjuhes shqipe
(veshtrim diakronik), Tirane 1997.
DEMIRAJ, B.: Si ta lexojme Leibniz-in, ne: „Studime
filologjike [2001] (1-2) 163-175, Tirane.
Demiraj, B.: Einheitlichkeit und Spaltung im Laufe
des Christianisierungsprozesses der Alba-
ner (Eine ethnolinguistische Fallstudie), ne:
„Studime 8-9 [2001-2002] 23-41, Prishtine
(= 2002a).
Demiraj, B.: Sprove per nje lexim kritik te korpusit
leksikor shqip ne vepren e Angelo Masci-t,
ne: „Studi in onore di Antonino Guzzeta
Palermo 2002, S. 115 - 131 (= 2002b).
Demiraj, B.: Aktet e Kuvendit te Arbenit dhe ren-
desia e tyre ne studimet albanologjike, ne
permbledhjen: Das albanische National-
konzil 1703. Kulturwissenschaftliche Ta-
gung in seinem 300. Jubileum. München —
13. September 2003 (bot. B. Demiraj),
Prishtine 2004, f. 70 - 87.
Demiraj, B.: Shqiptar!, ne: Seminari i 24-te Nder-
kombetar per Gjuhen, Letersine dhe Kul-
232
Bibliografi
turen Shqiptare. Prishtině, gusht 2005 ,
Prishtině 2005, S. 105 - 135 (= 2005a).
Demiraj, B.: Leibniz Stellung in der Geschichte der
Albanologie, ně: Festschrift für Wilfried
Fiedler . Hamburg 2005, S. 13 -31 (=
2005b).
Demiraj, B.: „Der Slawe , shqau, im Albanischen.
Eine ethnolinguistische Fallstudie zu Her-
kunft und Aussagekraft einer Fremdbe-
zeichnung, ně: Südost-Forschungen 65/
66 [2006/2007] 406-421.
DEMIRAJ, B.: Giorgio Guzzetta e le origini delia filo-
lógia italo-albanese, in: International
Journal of Diachronie Linguistics and
Linguistic Reconstruction 4 [2007] 63-81
(= 2007a).
Demiraj, B.: Aspekte tě mendimit intelektuál shqip-
tar ně shek. e 18-te. Ate Gjergj Guxeta dhe
vendi i tij ně historině e albanologjisě, ně:
Hylli i Dritěs 3 [2007] 9-37, Shkoděr (=
2007b).
Demiraj, B. (bot.): Dictionarium latino-epiroticum.
Per R. D. Franciscum Blanchum, (Romæ
1635), Shkoděr 2008.
Bibliografi
233
Demiraj, B.: Kur etnikét tregojnè: SHQA-u rider
shqiptaré, ne: Studime 16-17 [2009/2010]
231-249, Prishtiné.
Demiraj, B.: Albanian - Shqiptar, Naimi, Tirane 2010
(Engl. + Alb.) 66 + 66 f. (= 2010a)
Demiraj, B.: Probleme te lena pezull: vendbanimet e
shqiptareve ne mesjeten e hershme, in:
Hylli i Drites 1 [2010] 35 - 46, Shkoder (=
2010b).
Demiraj, B.: Gli insediamenti degli albanesi nelPalto
medioevo, ne: Scritti in onore di Eric
Pratt Hamp per il suo 90 compleanno
(bot. Gianni Belluscio - Antonino Mendi-
cino), Università della Calabria, Rende
2010, f. 73-83 (201Oc).
DEMIRAJ, B. (bot.): ConciÀi ProvintiaaÀi o Cuvendi j
Arbenit (Romae 1706). Botim kritik, Botime
frangeskane, Shkoder 2012, 504 f. (= 2012a)
Demiraj, B.: Umsiedler oder Alteingesessene? Fragen
zur Urheimat der Albaner im Frühmittel-
alter, ne: Südost-Forschungen 71 [2012]
379-389 (= 2012b).
DEMIRAJ, B.: Mallkimi i epirotit (1483), in: „Hylli i
Drites 1 [2012] 27-37, Shkoder (= 2012c).
234
Bibliografi
DEMIRAJ, B.: La maledizione del epirota, in: Res
albanicae I, 1 [2012] 133 - 149, Palermo (=
2012d).
Demiraj, B: Kumte domethénése dhe kundèrthénése
mbi albanét e dy Albanive, né „Anonymi
Descriptio Europae Orientalis (1308), in:
„Hylli i Drités 3-4 [2013] 204-216, Shko-
dér.
Demiraj, Sh.: Gramatike historike e gjuhès shqipe,
Tirane 1985.
Demiraj, Sh.: Prejardhja e shqiptaréve nén dritén e
déshmive té gjuhès shqipe, Tirane 1999.
Demiraj, Sh.: The origin of the Albanians; linguisti-
cally investigated, Tirane 2006.
Demiraj, Sh.: Gjuha shqipe dhe historia e saj. Botim i
dyté, i pèrditésuar, Tirane 2013.
Domi, M.: Probleme té historisé sé formimit tè gjuhès
shqipe, arritje dhe detyra, né: Studime
filologjike 3/4 [1982], Tirane.
ELSIE, R.: Histori e letérsisé shqiptare. Prishtinè 21997.
Floqi, K.: Origjina e mbiemnvet Shqypiare, Shqypni,
Albanoi, Albania, né: Hylli i Drités 11
[1935] 135-141.
Bibliografi
235
Gazulli, N.: Fjalorth i Ri (Fjale te rralla te perdoruna
ne Veri te Shqipnis), Tirane 1942.
Gurga, G.: shih me poshte ne rubriken Burimet te
DA Lecce, Fr. M.
Gjinari, J.: Dialektet e gjuhes shqipe. Tirane 1989.
Hahn, J. G. v.: Albanesische Studien, bl. I, Jena 1854.
Hetzer, A.: Shqipnia und Shqenia in Fishtas Laute
des Hochlandes , ne: Zeitschrift für
Balkanologie 36 [2000] 134-142.
Hetzer, A.: Die Schaffung der albanischen National-
sprache, ne: Studime 8-9 [2002] 67-101.
Ismajli, R.: Gjuha shqipe e kuvendit te Arbenit
(1706), Prishtine 1985.
Ismajli, R.: Emri i shqipetareve, ne: Artikuj mbi
gjuhen shqipe , Prishtine 1987, f. 96 — 105.
ISMAJLI, R.: Etni dhe modernitet, Prishtine 1991.
JlRECEK, K.: Albanien in der Vergangenheit, ne: Uly-
risch-albanische Forschungen. Zusammen-
gestellt von Dr. Ludwig von Thallötzy ,
Bleu I, München - Leipzig 1916, 68-93.
JlRECEK, K.: Skutari und sein Gebiet im Mittelalter,
ne: Illyrisch-albanische Forschungen. Zu-
sammengestellt von Dr. Ludwig von
236
Bibliografi
Thallötzy , Bleu I, München - Leipzig
1916, 94-124.
JlRECEK, K.: Valona im Mittelalter, ne: „Illyrisch-
albanische Forschungen , bl. I, München
u. Leipzig 1916 168-188.
JOCHALAS, T.: Die Einwanderung der Albaner in Grie-
chenland, ne: „Dissertationes Albanicae
(bot. Peter Bartl) München 1971, 89-106.
JOCHALAS, T.: Die albanische Sprache in Westthrakien,
ne: „Aktuelle Fragestellungen und Zu-
kunftperspektiven der Albanologie. Akten
der 4. Deutsch-Albanischen kulturwissen-
schaftlichen Tagung „50 Jahre Albanologie
an der Ludwig-Maximilians-Universität
München (bot. Bardhyl Demiraj) Wies-
baden 2012,161-166.
JOKL, N.: Zur Ortsnamenskunde Albaniens, ne:
„Zeitschrift für Ortsnamenforschung 10
[1934] 181-206.
Kacorri, Th.: Shpjegime te reja permbi etnonimin
shqiptar, shqiptare, Shqiperi, toskerisht dhe
shqyptar, shqyptare, Shqypni, gegerisht, ne:
Seminari XVII Nderkombetar per Gju-
hen. Letersine dhe Kulturen Shqiptare
(Tirane 16-31 gusht 1995), Tirane 1995.
Bibliografi
237
Kadare, I.: Mosmarrëveshja. Shqipëria përballë vetvetes
(botim i tretë, përfundimtar), Tiranë 2012.
Kahane, H. R.: Notes on the Linguistic History of
Sclavus, në: Studi in onore di Ettore lo
Gatto . Firenze 1962, 345-360.
Kelmendi, M. (bot.): „Kush asht kosovari? Identiteti
kosovar (debat) , Prishtinë 2005.
KÖDDERITZSCH, R.: Albanisch und Thrakisch, në:
„Studia albanica [2001] 79-87.
Konda, S.: Shqiptarët dhe probierni pellazgjik,
Tiranë 1962.
Korth, G. v.: Zur Etymologie des Wortes Slavus”
(Sklave), në: „Giotta 48 (1970), 145-53.
Lloshi, Xh.: Formimi i emrave përmbledhës nga
tema e shumësit, në: Studime filologjike
2 [1976] 15-35.
Mandala, M.: L opera inedita di Francesco Maria da
Lecce: il Dittionario Italiano-Albanese (1702),
në: Quaderni di Dipartimento Linguis-
tica nr. 14 (Albanistica 2), Roma 1997, f.
243-271.
Mandala, M.: Shqip, shqipëtar e shqipëni në Fjalorin e
pabotuar (1702) të Francesco Maria da
Lecce-s, në: Vepra themelore në Albano-
logji. Aktet e konferencës shkencore ndër-
238
Bibliografi
kombetare 18-20 dhjetor 2008 (bot. A.
Marashi), Tirane 2009, f. 152-161.
Matzinger, J.: Kritische Kurzbemerkungen zur nord-
albanischen Toponomastik: Die Namen
der urbanen Zentren in adriatischen
Küstenbereich, ne: „Nordalbanien -
1/Albania del Nord (botues M. Genesin
J. Matzinger), Hamburg 2009 87-101.
Meyer, G.: Etymologisches Wörterbuch der albane-
sischen Sprache. Straßburg 1891.
MiHĂESCU, H.: La langue latine dans le sud-est de
l’Europe. Bucureşti 1978.
MlKLOSlCH, Fr.: Die slavischen Elemente im Albani-
schen. Wien 1870.
Mjeda, N.: Bassania, ne: „Leka 7 [1935] 241-243, Shko-
der.
Myderrizi, O.: Emni i Shqipnis ne kohen e mesme,
ne: Hylli i Drites 17 [1943] 3-25.
Myderrizi, O.: Emri i vjeter kombetar i Shqiperise ne
tekstet e vjetra shqip me alfabet latin dhe
arab, ne: „Studime historike 1 [1965].
Mysliu, S. Dauti, D.: Shqiptaret e Ukraines. Udhe-
pershkrim dhe punime shkencore, Shkup
1996
Bibliografi
239
• * _
Olberg, H.: Die ursprünglichen Wohnsitze der Alba-
ner auf der Balkanhalbinsel, ne: „Darda-
nia 4 [1995] 7-9, Wien.
Orel, V.: Albanian Etymological Dictionary. Leiden,
Boston, Köln 1998.
PANajoti-Meksi, G. Th.: Prej nga rrjeth emeri shqip-
tar, ne: Hylli i Drites 11 [1935] 483 - 486.
Pedersen, H.: Die albanesischen 1-Laute, KZ 33
[1895] 535-551.
Riza, S.: Fillimet e gjuhesis shqiptare, ne: Vepra ,
bleu I, Prishtine 19962 (1952).
Sejdaj, E.: Etnonimi Arberesh-Shqiptar, Prishtine 1996,
136 f.
Schmitt, O. J.: Das venezianische Albanien (1392-
1479), R. Oldenburg Verlag - München 2001.
Schmitt, O. J. ( Franz, E. - botues): Albanische
Geschichte. Stand und Perspektiven der
Forschung, R. Oldenburg Verlag ֊ Mün-
chen 2009 (= 2009a).
Schmitt, O. J.: Skanderbeg. Der neue Alexander auf
dem Balkan, Friedrich Pustet - Regens-
burg 2009 (= 2009b).
Schmitt, O. J.: Skanderbeg - eine Reinterpretation,
ne: (M. Genesin, J. Matzinger G. Vallone
֊ bot.) The Living Skanderbeg. The Alba-
I
240
Bibliografi
nian Hero between Myth and History ,
Dr. Kovač - Hamburg, f. 237-245 (= 2010a).
Schmitt, O. J.: Einleitung, në: (A. Mosser - bot.)
Religion und Kultur im albanischspra-
chigen Südosteuropa, Peter Lang — Wien
et al. 2010, f. 7-13 (= 2010b).
Schramm, G.: Eroberer und Eingesessene, Stuttgart
1981.
Schramm, G.: Anfänge des albanischen Christen-
tums. Die frühe Bekehrung der Bessen
und ihre langen Folgen, Freiburg/Br 1994.
SlRDANl, M.: Êmni shqiptar e arbnuer, në: Hylli i
Dritës 7 [1931] 198-204, 635-639.
SlRDANl, M.: Shqypnia dhe shqyptarët, në: Hylli i
Dritës - Serje e re — Nr. 9, Shkodër 1941.
SKOK, F.: Etimologijski rječnik hrvatskoga ili srp-
skoga jezika, bl. III. Zagreb 1973.
Skok, P.: Slave et albanais, në: Arh. Arb. Star. 2
(1924), 107-126.
Svane, G.: Slavische Lehnwörter im Albanischen.
Aarhus 1992.
Stadtmüller, G.: Forschungen zur albanischen Früh-
geschichte. Zweite erweiterte Auflage,
Wiesbaden 1966.
Bibliografi
241
Sufflay, M.: Srbi i Arbanasi (Njihova simbioza u
srednjem vijeku), Zagreb 19912 (bot. I:
Beograd 1923). [Varianti i perkthyer shqip:
Serbet dhe shqiptaret, Tirane 20023]
Sufflay, M.: Das mittelalterliche Albanien, ne:
„Illyrisch-albanische Forschungen , bl. I,
München u. Leipzig 1916 282-288.
Shuteriqi, Dh.: Tekste te shqiptareve te Sllavonise,
ne: Buletin i Shkencave Shoqerore 2
[1955] 181-190.
Shuteriqi, Dh.: Mbi disa ;eshtje t Arberit dhe mbi
emrin Shqiperi, ne: Buletin i Shkencave
Shoqerore 3 [1956] 215vv.
Thunmann, J.: Über die Geschichte und Sprache der
Albaner und der Wlachen, ne: Untersu-
chungen über die Geschichte der östlichen
europäischen Völker , 1. Theil. Leipzig
1774 (19792 - Hamburg), S. 169 - 366.)
Treimer, K.: Der albanische Nationalname, gegisch
sk üp, toskisch sk ip, ne: „Indogermanische
Forschungen 35 [1915] 135-7.
VASMER, M.: Studien zur albanesischen Wortfor-
schung I, Dorpat 1921.
VASMER, M.: Die griechischen Lehnwörter im Serbo-
Kroatischen. Berlin 1944.
242
Bibliografi
Vasmer, M.: Russisches etymologisches Wörterbuch.
I-III, Heidelberg 1953-1958.
VĂTĂŞESCU, C.: Vocabularul de origine latină din
limba albaneză în comparaţie cu româna.
Bucureşti 1997.
Weigand, G.: Sind die Albaner die Nachkommen
der Illyrer oder der Thraker, në: „Balkan-
Archiv 3 [1927] 227-251, Leipzig.
Xylander, J. R. V.: Die Sprache der Albanesen oder
Schkipetaren, Frankfurt am Main, 1835.
Ylli, Xh.: Das slavische Lehngut im Albanischen, 1.
Teil. München 1997 (Slavistische Beiträge,
350).
Ylli, Xh: Das slavische Lehngut im Albanischen, 2.
Teil: Ortsnamen, München 2000.
Burimet
Acta et diplomata rés Albániáé Médiáé Aetatis illus-
trantia (Collegerunt et digesserunt Dr
Ludovicus de Thallóczy, Dr Constantinus
Jirecek et Dr Emilianus de Sufflay), vol. II
(annos 1344 - 1406 continens), Vindo-
bonae MCMXVIII (ribotim me fototipi
Tirane - Prishtine 2002 - Botues Shaban
Sinani, Skénder Blakaj).
Bibliografi
243
Ahmetaj, M.: Fjalor i te folmeve shqiptare ne Mal te
Zi. Prishtine 1996.
Ahmetaj, M.: E folmja e Plaves dhe e Gucise.
Prishtine 2002.
Arbanas, L.: Deutsch-Albanisches und Albanisch-
deutsches Wörterbuch. Wien, Leipzig
1912.
Bardhi, Fr. [= Franciscus Blanchus]: Dictionarium
latino-epiroticum. Per R. D. Franciscum
Blanchum, Romae 1635.
BariC, H.: Recnik srpskoga ili hrvatskoga i
arbanskoga jezika, bl. 1. Zagreb 1950.
Bartl, P.: Quellen und Materialien zur albanischen
Geschichte im 17. und 18. Jahrhundert, bl.
II, ne: „Albanische Forschungen Nr. 20,
Wiesbaden 1979.
Bartoli, M.: Das Dalmatische, bl. I-II, Wien 19061
(19732).
BASHKIMI-Shoq.: Fjaluer i Rii i Shcypes. Perbäam Preie
Shocniiet Bashkimit. Shkoder 1908 (Prishti-
ne 19782).
Battaglia: Grande Dizionario della Lingua Italiana,
(t. XVII), Torino 1994.
li
244
Bibliografi
Bogdani, P. [= Peter Bogdan]: Cvnevs Prophetarum
de Christo Salvatore Mvndi, et eivs
Evangelica Veritate; italice, et epirotice
contexta; Et in duas Partes divisa a Petro
Bogdano macedone [...]. Patavini 1685.
ConciAi ProvintiaaAi o Cuvendi j Arbenit; Mbelie-
£,une nde viett gnai mije sctat cint e tre
ndene Clementit i GnimiEietmi Pape Pre-
temaS.it, Romae, Typis Sac. Congregationis
de Propaganda Fide, Anno MDCCVI
(riprodhim me fototipi ne: Kuvendi i
Arbenit Prishtiné 2003 - Botues Konfe-
renca Ipeshkvore Shqiptare - f. 133 - 245).
Sh. edhe lart Demiraj, B. 2012.
Concilli i Eéut Scciypniis, baamun n viet 1703 n coh
tTaps Scciyptarit Clementit t Gnim£,ettit (i
kaa citt scciyp Don Egnell Radoja),
n Rom, me sctamp t cuvenit S.T Propa-
gands, 1872. (riprodhim me fototipi ne:
Kuvendi i Arbenit Prishtiné 2003 -
Botues Konferenca Ipeshkvore Shqiptare ֊
f. 249 - 363).
Chetta, N. [= Nikolle Keta]: shih mé lart né rubriken
Literature e cituar .
Bibliografi
245
CORDIGNANO, F.: Dizionario Albanese-Italiano e Ita-
liano-Albanese. Parte Albanese-Italiana.
Milano 1934.
Da Lecce, Fr. M.: Dizionario Italiano - Albanese
(1702 - dsh). Botim kritik me hyrje dhe
fjalésim shqip, pérgatitur nga Gézim
Gurga. Botimi I, Shkodèr 2009.
Figlia, N. [= Nikollé Filia]: Il codice chieutino (Ed.
critica e concordanza a cura di Matteo
Mandala), Mezzoiuso 1995.
Fjalor enciklopedik shqiptar. Tirane 1985. (= FESH).
Fjalor Enciklopedik Shqiptar, bl. I - III, Tirane 2008-
2009 (FESH2).
Fjalori i gjuhès shqipe. Tirane 1954 (= FGJSH).
Fjalor i gjuhès shqipe. Tirane 2006 (= FGJSH).
Fjalor i shqipes se sotme, 1984, 20022 (= FSHS).
Giordano, E.: Fjalor i arbèreshéve té Italisé - Dizio-
nario degli albanesi d Italia. Bari 1963.
Guagliata, Z.: Dottrina e Kerscten CardinàÀit Bel-
larmino t sciochnìet Jesus, Rom 1845,
21856.
Hahn, J. G.: Albanesische Studien, bl. III. Beitràge zu
einem albanesisch-deutschen Lexikon. Wien
1854.
246
Bibliografi
Haxhillazi, P. Ahmeti, S. B.: Fjalor i shqipes së
Plavës dhe të Gucisë. Tirane 2004.
ISLAMI, S. : Matériel linguistique des colonies albanai-
ses d Ucraine, Studia albanica 2 (1965),
165-187.
JOCHALAS, T.: ΑΝΔΡΟΣ. Αρβανίτες και Αρβανίτικα.
Αθήνα 2000.
JOCHALAS, Τ.: ΕΥΒΟΙΑ. Τα Αρβανίτικα. Αθήνα 2002.
JOCHALAS, Τ.: Ύδρα. Λησμονημένη γλώσσα, bi. I.
Αθήνα 2006.
JUNGG, G.: Fialur i voghel sccyp e ltinisct. Sckoder
1895.
Kuvendi i Arbënit: ConciAi ProvintiaaAi o Cuvendi j
Arbenit. Mbelie£une nde viett gnai mije
sctat cint e tre ndene Clementit i Gnimi-
4ietmi Pape Pretesa. Rom 1706 (KA1 -
Prishtinë 20032).
Kristoforidhi, K.: Fjalor shqip-greqisht. Athen 1903
(Tiranë 19612).
KRSTIĆ, K.: Rječnik Govora Zadarskih Arbanasa. Zadar
1987.
Leotti, Angelo: Dizionario Albanese-Italiano. Roma
1937.
Lessico Universale Italiano, bl. 20. Roma 1978 (= LUI).
Bibliografi
247
Makušev, V.: Monumenta historia slavorum meri-
dionalium vicinorumque populorum de-
prompta e tabularis e bibliothecis italicis,
II. Belgrad 1882.
Mann, S. E.: An Historical Albanian-English Dictio-
nary. London, New York, Toronto 1948.
Muraţi, Q.: Fjalor i shqipes truallsore te Maqedoni-
se. Tetove 1998.
Muraţi, Q.: Fjalor i fjaleve te rralla te perdorura ne
viset shqiptare te Maqedonise. Shkup 2003.
Mysliu, S. Dauti, D.: Shqiptaret e Ukraines. Udhe-
pershkrim dhe punime shkencore. Shkup
1996.
Noli, F. S.: Gjergj Kastrioti Skenderbeu (1405 — 1468),
ne: Fan S. Noli, Vepra IV: Studime histo-
rike, Tirane 19893 (bot. origjinal: George
Castrioti Scanderbeg (1405-1468) by Bi-
shop Fan Stylian Noli, Ph. D., Interna-
tional Universities Press, New York 1947).
Papahagi, T.: Dicţionarul dialectului aromîn, Bucu-
reşti 1963.
Radoja, E.: Dotrinna e Kerscten. N Sckoder 1876.
Radonić, Jovan: Đurađ Kastriot Skenderbeg i Arba-
nija u XV veku, Srpska Kraljevska Akade-
mija. Spomenik XCV ֊ Belgrad 1942.
248
Bibliografi
Reinhold, Th.: Noctes pelasgicae. Athen 1954 (Lexi-
kon-Teil).
Sasse, H.-J.: Arvanitika. Die albanischen Sprachreste
in Griechenland, Teil I. Wiesbaden 1991.
Shuteriqi, Dh.: Fjalorth i tě folmes shqipe tě fshatit
Mandricě, “Studíme Filologjike 2 (1965),
153-170.
Sokolova, B.: Die albanische Mundart von Mandri-
ca. Berlin 1983.
Tagliavini, C.: L albanese di Dalmazia. Firenze 1937.
TASE, P.: Fjalorth i Ri. Fjalě tě rralla tě pěrdoruna ně
jug tě Shqipnis. Tirane 1941.
Truhelka, Č.: Deutsch-albanisches Wörterbuch, (bot.
M. Ahmeti) Zagreb 1995 [- Ms. 1899].
Weigand, G.: Albanesisch-deutsches und deutsch-
albanesisches Wörterbuch. Leipzig 1914.
WlNDiSCH, von: Von den Klementinem in Sirmien,
ně: „Ungarisches Magazin , bl. 2., Preß-
burg 1782.
Treguesi i emrave
Ahmetaj, Mehmet 162,164
Altimari, Francesco 66,
102,176,179
Arapi, Ina 153
Ashta, Kolè 21
Baric, Henerik 165
Bartl, Peter 119
Bardhi, Frang 17, 18, 19,
20, 21, 93, 104, 131,
132,178,187
Bellusci, Antonio 179
Bogdani, Pjetér 104,119,
127,145,148, 149, 151,
166,167,187, 193
Brancati, Nicolò 77-78,
82,97
Buda, Aleks 110-111,132,
133
Budi, Pjetér 104, 144,145,
146, 147, 148, 151,154,
155
Buzuku, Gjon 92,120-
121,143,144,145,151-
152,154,155
Chetta, Nicolò 22, 70-71,
72-76, 82, 94, 95, 99,
105,107,118,178
Clayer, Nathalie 41
Cordignano, Fluvio 177,
178, 179,180
Curta, Florin 183
Çabej, Eqrem 25, 27, 66,
87, 90, 92,100,111-112
Da Lecce, Francesco M.
58, 78-81, 92, 99,107,
108, 109-110, 125, 129,
135, 137,139,140,143,
151, 164, 177, 178
Dara i Riu, Gavril 153
Dauti, Daut 66, 97
Demiraj, Bardhyl 22, 37,
38, 52, 59,103, 104,
226
Treguesi i emrave
106,128, 129,134,137,
160, 171, 185, 203, 215,
218, 222
Demiraj, Shabarı 24, 66,
82, 86, 93, 100, 101,
111, 116-117, 125, 144,
150, 153, 155, 183, 203
Domi, Mahir 25
Elsie, Robert 172
Fallmerayer, Jakob Ph.
186
Figlia, Nicolö 77
Frakulla, Nezim 145,150,
151
Fucarino, Giuseppa 71
Gazulli, Nikolle 137
Guagliata, Giuseppe 164,
171
Gurga, Gezim 59, 81,
106,109,128,134-135,
139
Guzzetta, Giorgio 22
Gjinari, Jorgji 222
Hahn, Johann G. v. 24,
64, 96, 98, 99, 101,105,
138, 165, 178, 179
Hetzer, Armin 115,162
Islami, Selim 175
Ismajli, Rexhep 67, 86,
88, 91, 101, 105, 112-
114, 116
Jireček, Karl 85, 89, 206,
215
Jóchalas, Titos 66, 165,
175, 176, 177, 179, 180
Joki, Norbert 24, 222
Jungg, Giacomo 177,178
Kacorri, Thoma 100
Kadaré, Ismail 13, 54
Kastrioti, Gjergj 17,18,
20, 36
Kelmendi, Migjen 33
Konda, Spiro 25
Korth, G. V. 183, 184
Kristoforidhi,
Konstandin 164, 177,
178, 179, 180
Krstić, Kruno 166,173,177
Leibniz, Gottfried W. 22
Leotti, Angelo 165
Livius, Titus 223
Logoreci, Matí 165,180
Treguesi i emrave
227
Lloshi, Xhevat 91
Makusev 20
Mandala, Matteo 59, 71,
77, 81,119,128,135,
136,137,138,139-140,
153
Mann, Stuart 164,165,
166,177,179,180
Masci, Angelo 22, 25
Matzinger, Joachim 59,
128, 144, 151, 153, 155,
219
Meyer, Gustav 24, 83, 96,
100, 101, 138, 181, 186
Meyer-Lübke, Wilhelm
182
Mihâescu, Haralambie
182
Miklosich, Franz 175,
176, 177, 178, 181
Mjeda, Ndre 25, 223
Murati, Qemal 160, 164,
180
Musliu, Sefer 66, 97
Myderrizi, Osman 86,
115-116, 117, 118, 150
Noli, Fan S. 20
Nopcsa, Franz Baron v.
24
Novik, Aleksandër 175
• ·
Olberg, Hermann 203
Orel, Vladimir 100,182
Panajoti-Meksi, G. 100
Papahagi,Tache 65
Pedersen, Holger 24,
209-210, 224
Ptolemeus, Claudius
103, 204
Radoja, Ât Engjëll 106,
143, 171
Radonic, Jovan 20
Reinhold, Kari 175
Rıza, Selman 86, 88, 93,
98
Sasse, Hans J. 176
Scaldaferri, Nicola 179
Schmitt, Oliver J. 35, 36,
37, 38, 39-49, 112
Schramm, Gottfried 203,
215,1 219
Sejdaj, Engjëll 59, 86, 88,
100, 116
228
Treguesi i emrave
Sequester, Vibius 221
Skok, Petar 165, 182, 183,
184
Sokolova, Bojka 173, 177,
179
Shuteriqi, Dhimiter 91,
137, 173, 177, 178
Stadtmuller, Georg 126,
201, 203, 220, 221
Svane, Gunnar 183, 212
Sufflay, Milan 82-83, 85,
86, 89, 90, 118-119, 205
Tagliavini, Carlo 179
Tase, Pano 173, 178
Thallóczy, Ludwig v. 24,85
Thunmann, Johann 22,
62, 63-4, 69-70, 99, 105,
106
Treimer, Karl 100
Truhelka, Ciro 177, 179
|
any_adam_object | 1 |
author | Demiraj, Bardhyl 1958- |
author_GND | (DE-588)120015935 |
author_facet | Demiraj, Bardhyl 1958- |
author_role | aut |
author_sort | Demiraj, Bardhyl 1958- |
author_variant | b d bd |
building | Verbundindex |
bvnumber | BV042392322 |
ctrlnum | (OCoLC)904437044 (DE-599)BVBBV042392322 |
era | Sozialgeschichte 500-1050 gnd Geschichte gnd |
era_facet | Sozialgeschichte 500-1050 Geschichte |
format | Book |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>02964nam a2200613 c 4500</leader><controlfield tag="001">BV042392322</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20171011 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">150305s2014 a||| |||| 00||| alb d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9789928109750</subfield><subfield code="9">978-9928-109-75-0</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)904437044</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV042392322</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">alb</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-19</subfield><subfield code="a">DE-12</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">OST</subfield><subfield code="q">DE-12</subfield><subfield code="2">fid</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Demiraj, Bardhyl</subfield><subfield code="d">1958-</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)120015935</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Shqiptar dhe shqa</subfield><subfield code="b">histori popujsh përmes dy emrave etnikë : (triptik etnolinguistik)</subfield><subfield code="c">Bardhyl Demiraj</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Tiranë</subfield><subfield code="b">Naimi</subfield><subfield code="c">2014</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">248 Seiten</subfield><subfield code="b">Illustrationen, Karten</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Sozialgeschichte 500-1050</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Albaner</subfield><subfield code="0">(DE-588)4068517-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Albanisch</subfield><subfield code="0">(DE-588)4112482-0</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Kulturkontakt</subfield><subfield code="0">(DE-588)4033569-0</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Exonym</subfield><subfield code="0">(DE-588)4632516-5</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Shqiptar</subfield><subfield code="g">Wort</subfield><subfield code="0">(DE-588)7825934-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Nachbarvolk</subfield><subfield code="0">(DE-588)4299286-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Shqa</subfield><subfield code="g">Wort</subfield><subfield code="0">(DE-588)1141245965</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Ethnographischer Name</subfield><subfield code="0">(DE-588)4273620-1</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Albanisch</subfield><subfield code="0">(DE-588)4112482-0</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Ethnographischer Name</subfield><subfield code="0">(DE-588)4273620-1</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Shqiptar</subfield><subfield code="g">Wort</subfield><subfield code="0">(DE-588)7825934-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Exonym</subfield><subfield code="0">(DE-588)4632516-5</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="4"><subfield code="a">Shqa</subfield><subfield code="g">Wort</subfield><subfield code="0">(DE-588)1141245965</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="5"><subfield code="a">Geschichte</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="1" ind2="0"><subfield code="a">Albaner</subfield><subfield code="0">(DE-588)4068517-2</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="1"><subfield code="a">Nachbarvolk</subfield><subfield code="0">(DE-588)4299286-2</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="2"><subfield code="a">Kulturkontakt</subfield><subfield code="0">(DE-588)4033569-0</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="3"><subfield code="a">Sozialgeschichte 500-1050</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="1" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB Muenchen 24 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027828184&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB Muenchen 24 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027828184&sequence=000002&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Literaturverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB Muenchen 24 - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027828184&sequence=000003&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Register // Personenregister</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">oe</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-027828184</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">306.09</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09021</subfield><subfield code="g">496</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">417.7</subfield><subfield code="e">22/bsb</subfield><subfield code="g">4965</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">306.09</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09021</subfield><subfield code="g">4965</subfield></datafield></record></collection> |
id | DE-604.BV042392322 |
illustrated | Illustrated |
indexdate | 2024-07-10T01:20:19Z |
institution | BVB |
isbn | 9789928109750 |
language | Albanian |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-027828184 |
oclc_num | 904437044 |
open_access_boolean | |
owner | DE-19 DE-BY-UBM DE-12 |
owner_facet | DE-19 DE-BY-UBM DE-12 |
physical | 248 Seiten Illustrationen, Karten |
publishDate | 2014 |
publishDateSearch | 2014 |
publishDateSort | 2014 |
publisher | Naimi |
record_format | marc |
spelling | Demiraj, Bardhyl 1958- Verfasser (DE-588)120015935 aut Shqiptar dhe shqa histori popujsh përmes dy emrave etnikë : (triptik etnolinguistik) Bardhyl Demiraj Tiranë Naimi 2014 248 Seiten Illustrationen, Karten txt rdacontent n rdamedia nc rdacarrier Sozialgeschichte 500-1050 gnd rswk-swf Geschichte gnd rswk-swf Albaner (DE-588)4068517-2 gnd rswk-swf Albanisch (DE-588)4112482-0 gnd rswk-swf Kulturkontakt (DE-588)4033569-0 gnd rswk-swf Exonym (DE-588)4632516-5 gnd rswk-swf Shqiptar Wort (DE-588)7825934-4 gnd rswk-swf Nachbarvolk (DE-588)4299286-2 gnd rswk-swf Shqa Wort (DE-588)1141245965 gnd rswk-swf Ethnographischer Name (DE-588)4273620-1 gnd rswk-swf Albanisch (DE-588)4112482-0 s Ethnographischer Name (DE-588)4273620-1 s Shqiptar Wort (DE-588)7825934-4 s Exonym (DE-588)4632516-5 s Shqa Wort (DE-588)1141245965 s Geschichte z DE-604 Albaner (DE-588)4068517-2 s Nachbarvolk (DE-588)4299286-2 s Kulturkontakt (DE-588)4033569-0 s Sozialgeschichte 500-1050 z Digitalisierung BSB Muenchen 24 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027828184&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis Digitalisierung BSB Muenchen 24 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027828184&sequence=000002&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA Literaturverzeichnis Digitalisierung BSB Muenchen 24 - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027828184&sequence=000003&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA Register // Personenregister |
spellingShingle | Demiraj, Bardhyl 1958- Shqiptar dhe shqa histori popujsh përmes dy emrave etnikë : (triptik etnolinguistik) Albaner (DE-588)4068517-2 gnd Albanisch (DE-588)4112482-0 gnd Kulturkontakt (DE-588)4033569-0 gnd Exonym (DE-588)4632516-5 gnd Shqiptar Wort (DE-588)7825934-4 gnd Nachbarvolk (DE-588)4299286-2 gnd Shqa Wort (DE-588)1141245965 gnd Ethnographischer Name (DE-588)4273620-1 gnd |
subject_GND | (DE-588)4068517-2 (DE-588)4112482-0 (DE-588)4033569-0 (DE-588)4632516-5 (DE-588)7825934-4 (DE-588)4299286-2 (DE-588)1141245965 (DE-588)4273620-1 |
title | Shqiptar dhe shqa histori popujsh përmes dy emrave etnikë : (triptik etnolinguistik) |
title_auth | Shqiptar dhe shqa histori popujsh përmes dy emrave etnikë : (triptik etnolinguistik) |
title_exact_search | Shqiptar dhe shqa histori popujsh përmes dy emrave etnikë : (triptik etnolinguistik) |
title_full | Shqiptar dhe shqa histori popujsh përmes dy emrave etnikë : (triptik etnolinguistik) Bardhyl Demiraj |
title_fullStr | Shqiptar dhe shqa histori popujsh përmes dy emrave etnikë : (triptik etnolinguistik) Bardhyl Demiraj |
title_full_unstemmed | Shqiptar dhe shqa histori popujsh përmes dy emrave etnikë : (triptik etnolinguistik) Bardhyl Demiraj |
title_short | Shqiptar dhe shqa |
title_sort | shqiptar dhe shqa histori popujsh permes dy emrave etnike triptik etnolinguistik |
title_sub | histori popujsh përmes dy emrave etnikë : (triptik etnolinguistik) |
topic | Albaner (DE-588)4068517-2 gnd Albanisch (DE-588)4112482-0 gnd Kulturkontakt (DE-588)4033569-0 gnd Exonym (DE-588)4632516-5 gnd Shqiptar Wort (DE-588)7825934-4 gnd Nachbarvolk (DE-588)4299286-2 gnd Shqa Wort (DE-588)1141245965 gnd Ethnographischer Name (DE-588)4273620-1 gnd |
topic_facet | Albaner Albanisch Kulturkontakt Exonym Shqiptar Wort Nachbarvolk Shqa Wort Ethnographischer Name |
url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027828184&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027828184&sequence=000002&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027828184&sequence=000003&line_number=0003&func_code=DB_RECORDS&service_type=MEDIA |
work_keys_str_mv | AT demirajbardhyl shqiptardheshqahistoripopujshpermesdyemraveetniketriptiketnolinguistik |