Emerging challenges in privacy law: comparative perspectives
"This collection of essays explores current developments in privacy law, including reform of data protection laws, privacy and the media, social control and surveillance, privacy and the Internet, and privacy and the courts. It places these developments into a broader international context, wit...
Gespeichert in:
| Format: | Buch |
|---|---|
| Sprache: | English |
| Veröffentlicht: |
Cambridge
Cambridge Univ. Press
2014
|
| Schriftenreihe: | Cambridge intellectual property and information law
23 |
| Schlagworte: | |
| Online-Zugang: | Cover image Inhaltsverzeichnis |
| Zusammenfassung: | "This collection of essays explores current developments in privacy law, including reform of data protection laws, privacy and the media, social control and surveillance, privacy and the Internet, and privacy and the courts. It places these developments into a broader international context, with a particular focus on the European Union, the United Kingdom, Australia and New Zealand. Adopting a comparative approach, it creates an important resource for understanding international trends in the reform of privacy and data protection laws across a variety of contexts. Written by internationally recognised experts, Emerging Challenges in Privacy Law: Comparative Perspectives provides an accessible introduction to contemporary legal and policy debates in privacy and data protection law. It is essential reading for academics, policy makers and practitioners interested in current challenges facing privacy and data protection law in Europe and in the common law world".. |
| Beschreibung: | Includes bibliographical references and index |
| Beschreibung: | XVII, 448 S. |
| ISBN: | 9781107041677 |
Internformat
MARC
| LEADER | 00000nam a2200000 cb4500 | ||
|---|---|---|---|
| 001 | BV041761602 | ||
| 003 | DE-604 | ||
| 005 | 20140616 | ||
| 007 | t | ||
| 008 | 140327s2014 xxu |||| 00||| eng d | ||
| 010 | |a 013048031 | ||
| 020 | |a 9781107041677 |9 978-1-107-04167-7 | ||
| 035 | |a (OCoLC)881845459 | ||
| 035 | |a (DE-599)BVBBV041761602 | ||
| 040 | |a DE-604 |b ger |e aacr | ||
| 041 | 0 | |a eng | |
| 044 | |a xxu |c US | ||
| 049 | |a DE-M382 |a DE-12 | ||
| 050 | 0 | |a K3263 | |
| 082 | 0 | |a 342.08/58 |2 23 | |
| 245 | 1 | 0 | |a Emerging challenges in privacy law |b comparative perspectives |c ed. by Normann Witzleb ... |
| 264 | 1 | |a Cambridge |b Cambridge Univ. Press |c 2014 | |
| 300 | |a XVII, 448 S. | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 1 | |a Cambridge intellectual property and information law |v 23 | |
| 500 | |a Includes bibliographical references and index | ||
| 520 | |a "This collection of essays explores current developments in privacy law, including reform of data protection laws, privacy and the media, social control and surveillance, privacy and the Internet, and privacy and the courts. It places these developments into a broader international context, with a particular focus on the European Union, the United Kingdom, Australia and New Zealand. Adopting a comparative approach, it creates an important resource for understanding international trends in the reform of privacy and data protection laws across a variety of contexts. Written by internationally recognised experts, Emerging Challenges in Privacy Law: Comparative Perspectives provides an accessible introduction to contemporary legal and policy debates in privacy and data protection law. It is essential reading for academics, policy makers and practitioners interested in current challenges facing privacy and data protection law in Europe and in the common law world".. | ||
| 650 | 7 | |a LAW / Intellectual Property / General |2 bisacsh | |
| 650 | 4 | |a Privacy, Right of | |
| 650 | 4 | |a LAW / Intellectual Property / General | |
| 700 | 1 | |a Witzleb, Normann |d 1966- |e Sonstige |0 (DE-588)123897424 |4 oth | |
| 830 | 0 | |a Cambridge intellectual property and information law |v 23 |w (DE-604)BV040027764 |9 23 | |
| 856 | 4 | |u http://assets.cambridge.org/97811070/41677/cover/9781107041677.jpg |3 Cover image | |
| 856 | 4 | 2 | |m LoC Fremddatenuebernahme |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027207748&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-027207748 | ||
Datensatz im Suchindex
| _version_ | 1804152065443758080 |
|---|---|
| adam_text | EMERGING CHALLENGES IN PRIVACY LAW
/ / /
: : : 2014
TABLE OF CONTENTS / INHALTSVERZEICHNIS
^^ - INTERIM INJUNCTIONS FOR INVASIONS OF PRIVACY: CHALLENGING THE RULE
IN BONNARD V. PERRYMAN NORMANN WITZLEB
DIESES SCHRIFTSTUECK WURDE MASCHINELL ERZEUGT.
|
| any_adam_object | 1 |
| author_GND | (DE-588)123897424 |
| building | Verbundindex |
| bvnumber | BV041761602 |
| callnumber-first | K - Law |
| callnumber-label | K3263 |
| callnumber-raw | K3263 |
| callnumber-search | K3263 |
| callnumber-sort | K 43263 |
| callnumber-subject | K - General Law |
| ctrlnum | (OCoLC)881845459 (DE-599)BVBBV041761602 |
| dewey-full | 342.08/58 |
| dewey-hundreds | 300 - Social sciences |
| dewey-ones | 342 - Constitutional and administrative law |
| dewey-raw | 342.08/58 |
| dewey-search | 342.08/58 |
| dewey-sort | 3342.08 258 |
| dewey-tens | 340 - Law |
| discipline | Rechtswissenschaft |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>02601nam a2200409 cb4500</leader><controlfield tag="001">BV041761602</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20140616 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">140327s2014 xxu |||| 00||| eng d</controlfield><datafield tag="010" ind1=" " ind2=" "><subfield code="a">013048031</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781107041677</subfield><subfield code="9">978-1-107-04167-7</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)881845459</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV041761602</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">aacr</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">xxu</subfield><subfield code="c">US</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-M382</subfield><subfield code="a">DE-12</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">K3263</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">342.08/58</subfield><subfield code="2">23</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Emerging challenges in privacy law</subfield><subfield code="b">comparative perspectives</subfield><subfield code="c">ed. by Normann Witzleb ...</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Cambridge</subfield><subfield code="b">Cambridge Univ. Press</subfield><subfield code="c">2014</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">XVII, 448 S.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Cambridge intellectual property and information law</subfield><subfield code="v">23</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references and index</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">"This collection of essays explores current developments in privacy law, including reform of data protection laws, privacy and the media, social control and surveillance, privacy and the Internet, and privacy and the courts. It places these developments into a broader international context, with a particular focus on the European Union, the United Kingdom, Australia and New Zealand. Adopting a comparative approach, it creates an important resource for understanding international trends in the reform of privacy and data protection laws across a variety of contexts. Written by internationally recognised experts, Emerging Challenges in Privacy Law: Comparative Perspectives provides an accessible introduction to contemporary legal and policy debates in privacy and data protection law. It is essential reading for academics, policy makers and practitioners interested in current challenges facing privacy and data protection law in Europe and in the common law world"..</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">LAW / Intellectual Property / General</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Privacy, Right of</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">LAW / Intellectual Property / General</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Witzleb, Normann</subfield><subfield code="d">1966-</subfield><subfield code="e">Sonstige</subfield><subfield code="0">(DE-588)123897424</subfield><subfield code="4">oth</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Cambridge intellectual property and information law</subfield><subfield code="v">23</subfield><subfield code="w">(DE-604)BV040027764</subfield><subfield code="9">23</subfield></datafield><datafield tag="856" ind1="4" ind2=" "><subfield code="u">http://assets.cambridge.org/97811070/41677/cover/9781107041677.jpg</subfield><subfield code="3">Cover image</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">LoC Fremddatenuebernahme</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027207748&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-027207748</subfield></datafield></record></collection> |
| id | DE-604.BV041761602 |
| illustrated | Not Illustrated |
| indexdate | 2024-07-10T01:04:47Z |
| institution | BVB |
| isbn | 9781107041677 |
| language | English |
| lccn | 013048031 |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-027207748 |
| oclc_num | 881845459 |
| open_access_boolean | |
| owner | DE-M382 DE-12 |
| owner_facet | DE-M382 DE-12 |
| physical | XVII, 448 S. |
| publishDate | 2014 |
| publishDateSearch | 2014 |
| publishDateSort | 2014 |
| publisher | Cambridge Univ. Press |
| record_format | marc |
| series | Cambridge intellectual property and information law |
| series2 | Cambridge intellectual property and information law |
| spelling | Emerging challenges in privacy law comparative perspectives ed. by Normann Witzleb ... Cambridge Cambridge Univ. Press 2014 XVII, 448 S. txt rdacontent n rdamedia nc rdacarrier Cambridge intellectual property and information law 23 Includes bibliographical references and index "This collection of essays explores current developments in privacy law, including reform of data protection laws, privacy and the media, social control and surveillance, privacy and the Internet, and privacy and the courts. It places these developments into a broader international context, with a particular focus on the European Union, the United Kingdom, Australia and New Zealand. Adopting a comparative approach, it creates an important resource for understanding international trends in the reform of privacy and data protection laws across a variety of contexts. Written by internationally recognised experts, Emerging Challenges in Privacy Law: Comparative Perspectives provides an accessible introduction to contemporary legal and policy debates in privacy and data protection law. It is essential reading for academics, policy makers and practitioners interested in current challenges facing privacy and data protection law in Europe and in the common law world".. LAW / Intellectual Property / General bisacsh Privacy, Right of LAW / Intellectual Property / General Witzleb, Normann 1966- Sonstige (DE-588)123897424 oth Cambridge intellectual property and information law 23 (DE-604)BV040027764 23 http://assets.cambridge.org/97811070/41677/cover/9781107041677.jpg Cover image LoC Fremddatenuebernahme application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027207748&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Emerging challenges in privacy law comparative perspectives Cambridge intellectual property and information law LAW / Intellectual Property / General bisacsh Privacy, Right of LAW / Intellectual Property / General |
| title | Emerging challenges in privacy law comparative perspectives |
| title_auth | Emerging challenges in privacy law comparative perspectives |
| title_exact_search | Emerging challenges in privacy law comparative perspectives |
| title_full | Emerging challenges in privacy law comparative perspectives ed. by Normann Witzleb ... |
| title_fullStr | Emerging challenges in privacy law comparative perspectives ed. by Normann Witzleb ... |
| title_full_unstemmed | Emerging challenges in privacy law comparative perspectives ed. by Normann Witzleb ... |
| title_short | Emerging challenges in privacy law |
| title_sort | emerging challenges in privacy law comparative perspectives |
| title_sub | comparative perspectives |
| topic | LAW / Intellectual Property / General bisacsh Privacy, Right of LAW / Intellectual Property / General |
| topic_facet | LAW / Intellectual Property / General Privacy, Right of |
| url | http://assets.cambridge.org/97811070/41677/cover/9781107041677.jpg http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027207748&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| volume_link | (DE-604)BV040027764 |
| work_keys_str_mv | AT witzlebnormann emergingchallengesinprivacylawcomparativeperspectives |