Tales the textiles tell in the Lais of Marie de France: weaving as a signifying system
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
Lewiston, N.Y. [u.a.]
Edwin Mellen Press
2012
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | This book was awarded the Professor D. Simon Evans Prize for its distinguished contribution to scholarship in Medieval Studies. Includes bibliographical references and index |
| Beschreibung: | XII, 276 S. 24 cm |
| ISBN: | 9780773425972 0773425977 |
Internformat
MARC
| LEADER | 00000nam a2200000zc 4500 | ||
|---|---|---|---|
| 001 | BV040157311 | ||
| 003 | DE-604 | ||
| 005 | 20121106 | ||
| 007 | t | ||
| 008 | 120529s2012 xxu |||| 00||| eng d | ||
| 010 | |a 2011053195 | ||
| 020 | |a 9780773425972 |c hardcover |9 978-0-7734-2597-2 | ||
| 020 | |a 0773425977 |c hardcover |9 0-7734-2597-7 | ||
| 035 | |a (OCoLC)795643968 | ||
| 035 | |a (DE-599)BVBBV040157311 | ||
| 040 | |a DE-604 |b ger |e aacr | ||
| 041 | 0 | |a eng | |
| 044 | |a xxu |c US | ||
| 049 | |a DE-12 | ||
| 050 | 0 | |a PQ1494.L7 | |
| 082 | 0 | |a 841/.1 | |
| 100 | 1 | |a Gilmore-Hunt, Gloria Thomas |e Verfasser |0 (DE-588)1024914275 |4 aut | |
| 245 | 1 | 0 | |a Tales the textiles tell in the Lais of Marie de France |b weaving as a signifying system |c Gloria Thomas Gilmore-Hunt. With a foreword by Chantal A. Maréchal |
| 264 | 1 | |a Lewiston, N.Y. [u.a.] |b Edwin Mellen Press |c 2012 | |
| 300 | |a XII, 276 S. |c 24 cm | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 500 | |a This book was awarded the Professor D. Simon Evans Prize for its distinguished contribution to scholarship in Medieval Studies. | ||
| 500 | |a Includes bibliographical references and index | ||
| 600 | 1 | 4 | |a Marie |c de France |d 12th cent |t Lais |
| 600 | 0 | 7 | |a Marie |c de France |d 1135-1200 |t Les lais |0 (DE-588)4123712-2 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Textilien |0 (DE-588)4059615-1 |2 gnd |9 rswk-swf |
| 689 | 0 | 0 | |a Marie |c de France |d 1135-1200 |t Les lais |0 (DE-588)4123712-2 |D u |
| 689 | 0 | 1 | |a Textilien |0 (DE-588)4059615-1 |D s |
| 689 | 0 | |5 DE-604 | |
| 856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=025013914&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-025013914 | ||
Datensatz im Suchindex
| _version_ | 1804149185456373760 |
|---|---|
| adam_text | Titel: Tales the textiles tell in the Lais of Marie de France
Autor: Gilmore-Hunt, Gloria Thomas
Jahr: 2012
Table of Contents
Foreword by Chantal A. Marechal, PhD i
Acknowledgments xi
Introduction: Textiles as a Signifying System 1
Signs, Symbols, or Signals 1
History as Signs 3
A Feminine Perspective 5
Exploring Selfhood 10
Tresne 19
Chapter 1: The Relation of Textiles to Violence 25
As Pages 32
As Agents 44
Controlling Violence 59
As Texts 69
Passive Pages Actively Heal 87
Chapter 2: Textiles in the Generating of Subjectivity 97
Marie s Maternal Merveilleux 111
Substantiating Maternal Love 128
Bestowing Power 139
Synesthesia in Marie s Imaginary 148
Empowering Language 158
Chapter 3: Textiles as Confinment or Expression 169
Confining Textiles 172
Expressing Selfhood 181
Balancing Personal and Social Needs 193
Chapter 4: Conclusion 221
Summary of Themes 221
Interweaving 226
Form for Subjectivity 232
Selected Bibliography 235
Subsequent Readings 263
Index 267
|
| any_adam_object | 1 |
| author | Gilmore-Hunt, Gloria Thomas |
| author_GND | (DE-588)1024914275 |
| author_facet | Gilmore-Hunt, Gloria Thomas |
| author_role | aut |
| author_sort | Gilmore-Hunt, Gloria Thomas |
| author_variant | g t g h gtg gtgh |
| building | Verbundindex |
| bvnumber | BV040157311 |
| callnumber-first | P - Language and Literature |
| callnumber-label | PQ1494 |
| callnumber-raw | PQ1494.L7 |
| callnumber-search | PQ1494.L7 |
| callnumber-sort | PQ 41494 L7 |
| callnumber-subject | PQ - French, Italian, Spanish, Portuguese Literature |
| ctrlnum | (OCoLC)795643968 (DE-599)BVBBV040157311 |
| dewey-full | 841/.1 |
| dewey-hundreds | 800 - Literature (Belles-lettres) and rhetoric |
| dewey-ones | 841 - French poetry |
| dewey-raw | 841/.1 |
| dewey-search | 841/.1 |
| dewey-sort | 3841 11 |
| dewey-tens | 840 - Literatures of Romance languages |
| discipline | Romanistik |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01825nam a2200421zc 4500</leader><controlfield tag="001">BV040157311</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20121106 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">120529s2012 xxu |||| 00||| eng d</controlfield><datafield tag="010" ind1=" " ind2=" "><subfield code="a">2011053195</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9780773425972</subfield><subfield code="c">hardcover</subfield><subfield code="9">978-0-7734-2597-2</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">0773425977</subfield><subfield code="c">hardcover</subfield><subfield code="9">0-7734-2597-7</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)795643968</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV040157311</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">aacr</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">xxu</subfield><subfield code="c">US</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">PQ1494.L7</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">841/.1</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Gilmore-Hunt, Gloria Thomas</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1024914275</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Tales the textiles tell in the Lais of Marie de France</subfield><subfield code="b">weaving as a signifying system</subfield><subfield code="c">Gloria Thomas Gilmore-Hunt. With a foreword by Chantal A. Maréchal</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Lewiston, N.Y. [u.a.]</subfield><subfield code="b">Edwin Mellen Press</subfield><subfield code="c">2012</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">XII, 276 S.</subfield><subfield code="c">24 cm</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">This book was awarded the Professor D. Simon Evans Prize for its distinguished contribution to scholarship in Medieval Studies.</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references and index</subfield></datafield><datafield tag="600" ind1="1" ind2="4"><subfield code="a">Marie</subfield><subfield code="c">de France</subfield><subfield code="d">12th cent</subfield><subfield code="t">Lais</subfield></datafield><datafield tag="600" ind1="0" ind2="7"><subfield code="a">Marie</subfield><subfield code="c">de France</subfield><subfield code="d">1135-1200</subfield><subfield code="t">Les lais</subfield><subfield code="0">(DE-588)4123712-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Textilien</subfield><subfield code="0">(DE-588)4059615-1</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Marie</subfield><subfield code="c">de France</subfield><subfield code="d">1135-1200</subfield><subfield code="t">Les lais</subfield><subfield code="0">(DE-588)4123712-2</subfield><subfield code="D">u</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Textilien</subfield><subfield code="0">(DE-588)4059615-1</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=025013914&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-025013914</subfield></datafield></record></collection> |
| id | DE-604.BV040157311 |
| illustrated | Not Illustrated |
| indexdate | 2024-07-10T00:19:01Z |
| institution | BVB |
| isbn | 9780773425972 0773425977 |
| language | English |
| lccn | 2011053195 |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-025013914 |
| oclc_num | 795643968 |
| open_access_boolean | |
| owner | DE-12 |
| owner_facet | DE-12 |
| physical | XII, 276 S. 24 cm |
| publishDate | 2012 |
| publishDateSearch | 2012 |
| publishDateSort | 2012 |
| publisher | Edwin Mellen Press |
| record_format | marc |
| spelling | Gilmore-Hunt, Gloria Thomas Verfasser (DE-588)1024914275 aut Tales the textiles tell in the Lais of Marie de France weaving as a signifying system Gloria Thomas Gilmore-Hunt. With a foreword by Chantal A. Maréchal Lewiston, N.Y. [u.a.] Edwin Mellen Press 2012 XII, 276 S. 24 cm txt rdacontent n rdamedia nc rdacarrier This book was awarded the Professor D. Simon Evans Prize for its distinguished contribution to scholarship in Medieval Studies. Includes bibliographical references and index Marie de France 12th cent Lais Marie de France 1135-1200 Les lais (DE-588)4123712-2 gnd rswk-swf Textilien (DE-588)4059615-1 gnd rswk-swf Marie de France 1135-1200 Les lais (DE-588)4123712-2 u Textilien (DE-588)4059615-1 s DE-604 HBZ Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=025013914&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Gilmore-Hunt, Gloria Thomas Tales the textiles tell in the Lais of Marie de France weaving as a signifying system Marie de France 12th cent Lais Marie de France 1135-1200 Les lais (DE-588)4123712-2 gnd Textilien (DE-588)4059615-1 gnd |
| subject_GND | (DE-588)4123712-2 (DE-588)4059615-1 |
| title | Tales the textiles tell in the Lais of Marie de France weaving as a signifying system |
| title_auth | Tales the textiles tell in the Lais of Marie de France weaving as a signifying system |
| title_exact_search | Tales the textiles tell in the Lais of Marie de France weaving as a signifying system |
| title_full | Tales the textiles tell in the Lais of Marie de France weaving as a signifying system Gloria Thomas Gilmore-Hunt. With a foreword by Chantal A. Maréchal |
| title_fullStr | Tales the textiles tell in the Lais of Marie de France weaving as a signifying system Gloria Thomas Gilmore-Hunt. With a foreword by Chantal A. Maréchal |
| title_full_unstemmed | Tales the textiles tell in the Lais of Marie de France weaving as a signifying system Gloria Thomas Gilmore-Hunt. With a foreword by Chantal A. Maréchal |
| title_short | Tales the textiles tell in the Lais of Marie de France |
| title_sort | tales the textiles tell in the lais of marie de france weaving as a signifying system |
| title_sub | weaving as a signifying system |
| topic | Marie de France 12th cent Lais Marie de France 1135-1200 Les lais (DE-588)4123712-2 gnd Textilien (DE-588)4059615-1 gnd |
| topic_facet | Marie de France 12th cent Lais Marie de France 1135-1200 Les lais Textilien |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=025013914&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT gilmorehuntgloriathomas talesthetextilestellinthelaisofmariedefranceweavingasasignifyingsystem |