Small and micro combined heat and power (CHP) systems: advanced design, performance, materials and applications
Gespeichert in:
| Format: | Buch |
|---|---|
| Sprache: | Undetermined |
| Veröffentlicht: |
Oxford [u.a.]
Woodhead Publ. [u.a.]
2011
|
| Ausgabe: | 1. publ. |
| Schriftenreihe: | Woodhead publishing series in energy
18 |
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | XXIV, 528 S. Ill., graph. Darst. |
| ISBN: | 9781845697952 |
Internformat
MARC
| LEADER | 00000nam a2200000 cb4500 | ||
|---|---|---|---|
| 001 | BV037391413 | ||
| 003 | DE-604 | ||
| 005 | 20110617 | ||
| 007 | t | ||
| 008 | 110510s2011 ad|| |||| 00||| und d | ||
| 020 | |a 9781845697952 |9 978-1-84569-795-2 | ||
| 035 | |a (OCoLC)707085965 | ||
| 035 | |a (DE-599)BVBBV037391413 | ||
| 040 | |a DE-604 |b ger |e rakwb | ||
| 041 | |a und | ||
| 049 | |a DE-29T | ||
| 245 | 1 | 0 | |a Small and micro combined heat and power (CHP) systems |b advanced design, performance, materials and applications |c ed. by Robert Beith |
| 246 | 1 | 3 | |a Small and microcombined heat and power (CHP) systems |
| 250 | |a 1. publ. | ||
| 264 | 1 | |a Oxford [u.a.] |b Woodhead Publ. [u.a.] |c 2011 | |
| 300 | |a XXIV, 528 S. |b Ill., graph. Darst. | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 1 | |a Woodhead publishing series in energy |v 18 | |
| 650 | 0 | 7 | |a Kraft-Wärme-Kopplung |0 (DE-588)4134359-1 |2 gnd |9 rswk-swf |
| 689 | 0 | 0 | |a Kraft-Wärme-Kopplung |0 (DE-588)4134359-1 |D s |
| 689 | 0 | |5 DE-604 | |
| 700 | 1 | |a Beith, Barry |e Sonstige |4 oth | |
| 830 | 0 | |a Woodhead publishing series in energy |v 18 |w (DE-604)BV036553081 |9 18 | |
| 856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=022544296&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-022544296 | ||
Datensatz im Suchindex
| _version_ | 1804145680714825728 |
|---|---|
| adam_text | Titel: Small and micro-combined heat and power (CHP) systems
Autor: Beith, Robert
Jahr: 2011
|
| any_adam_object | 1 |
| building | Verbundindex |
| bvnumber | BV037391413 |
| ctrlnum | (OCoLC)707085965 (DE-599)BVBBV037391413 |
| edition | 1. publ. |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01443nam a2200349 cb4500</leader><controlfield tag="001">BV037391413</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20110617 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">110510s2011 ad|| |||| 00||| und d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781845697952</subfield><subfield code="9">978-1-84569-795-2</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)707085965</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV037391413</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">und</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-29T</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Small and micro combined heat and power (CHP) systems</subfield><subfield code="b">advanced design, performance, materials and applications</subfield><subfield code="c">ed. by Robert Beith</subfield></datafield><datafield tag="246" ind1="1" ind2="3"><subfield code="a">Small and microcombined heat and power (CHP) systems</subfield></datafield><datafield tag="250" ind1=" " ind2=" "><subfield code="a">1. publ.</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Oxford [u.a.]</subfield><subfield code="b">Woodhead Publ. [u.a.]</subfield><subfield code="c">2011</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">XXIV, 528 S.</subfield><subfield code="b">Ill., graph. Darst.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Woodhead publishing series in energy</subfield><subfield code="v">18</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Kraft-Wärme-Kopplung</subfield><subfield code="0">(DE-588)4134359-1</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Kraft-Wärme-Kopplung</subfield><subfield code="0">(DE-588)4134359-1</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Beith, Barry</subfield><subfield code="e">Sonstige</subfield><subfield code="4">oth</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Woodhead publishing series in energy</subfield><subfield code="v">18</subfield><subfield code="w">(DE-604)BV036553081</subfield><subfield code="9">18</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=022544296&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-022544296</subfield></datafield></record></collection> |
| id | DE-604.BV037391413 |
| illustrated | Illustrated |
| indexdate | 2024-07-09T23:23:18Z |
| institution | BVB |
| isbn | 9781845697952 |
| language | Undetermined |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-022544296 |
| oclc_num | 707085965 |
| open_access_boolean | |
| owner | DE-29T |
| owner_facet | DE-29T |
| physical | XXIV, 528 S. Ill., graph. Darst. |
| publishDate | 2011 |
| publishDateSearch | 2011 |
| publishDateSort | 2011 |
| publisher | Woodhead Publ. [u.a.] |
| record_format | marc |
| series | Woodhead publishing series in energy |
| series2 | Woodhead publishing series in energy |
| spelling | Small and micro combined heat and power (CHP) systems advanced design, performance, materials and applications ed. by Robert Beith Small and microcombined heat and power (CHP) systems 1. publ. Oxford [u.a.] Woodhead Publ. [u.a.] 2011 XXIV, 528 S. Ill., graph. Darst. txt rdacontent n rdamedia nc rdacarrier Woodhead publishing series in energy 18 Kraft-Wärme-Kopplung (DE-588)4134359-1 gnd rswk-swf Kraft-Wärme-Kopplung (DE-588)4134359-1 s DE-604 Beith, Barry Sonstige oth Woodhead publishing series in energy 18 (DE-604)BV036553081 18 HBZ Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=022544296&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Small and micro combined heat and power (CHP) systems advanced design, performance, materials and applications Woodhead publishing series in energy Kraft-Wärme-Kopplung (DE-588)4134359-1 gnd |
| subject_GND | (DE-588)4134359-1 |
| title | Small and micro combined heat and power (CHP) systems advanced design, performance, materials and applications |
| title_alt | Small and microcombined heat and power (CHP) systems |
| title_auth | Small and micro combined heat and power (CHP) systems advanced design, performance, materials and applications |
| title_exact_search | Small and micro combined heat and power (CHP) systems advanced design, performance, materials and applications |
| title_full | Small and micro combined heat and power (CHP) systems advanced design, performance, materials and applications ed. by Robert Beith |
| title_fullStr | Small and micro combined heat and power (CHP) systems advanced design, performance, materials and applications ed. by Robert Beith |
| title_full_unstemmed | Small and micro combined heat and power (CHP) systems advanced design, performance, materials and applications ed. by Robert Beith |
| title_short | Small and micro combined heat and power (CHP) systems |
| title_sort | small and micro combined heat and power chp systems advanced design performance materials and applications |
| title_sub | advanced design, performance, materials and applications |
| topic | Kraft-Wärme-Kopplung (DE-588)4134359-1 gnd |
| topic_facet | Kraft-Wärme-Kopplung |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=022544296&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| volume_link | (DE-604)BV036553081 |
| work_keys_str_mv | AT beithbarry smallandmicrocombinedheatandpowerchpsystemsadvanceddesignperformancematerialsandapplications AT beithbarry smallandmicrocombinedheatandpowerchpsystems |