Medieval capital markets: markets for renten, state formation and private investment in Holland (1300 - 1550)
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
Leiden [u.a.]
Brill
2009
|
| Schriftenreihe: | Global economic history series
2 |
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | Includes bibliographical references and index |
| Beschreibung: | XII, 316 S. Ill., graph. Darst. |
| ISBN: | 9789004175655 |
Internformat
MARC
| LEADER | 00000nam a2200000 cb4500 | ||
|---|---|---|---|
| 001 | BV035545707 | ||
| 003 | DE-604 | ||
| 005 | 20130327 | ||
| 007 | t | ||
| 008 | 090602s2009 xxuad|| |||| 00||| eng d | ||
| 010 | |a 2009007794 | ||
| 020 | |a 9789004175655 |c hardback : alk. paper |9 978-90-04-17565-5 | ||
| 035 | |a (OCoLC)312728523 | ||
| 035 | |a (DE-599)BVBBV035545707 | ||
| 040 | |a DE-604 |b ger |e aacr | ||
| 041 | 0 | |a eng | |
| 044 | |a xxu |c US | ||
| 049 | |a DE-12 |a DE-355 |a DE-29 |a DE-11 | ||
| 050 | 0 | |a HG5562 | |
| 082 | 0 | |a 332/.041094920902 | |
| 084 | |a NW 2000 |0 (DE-625)131968: |2 rvk | ||
| 084 | |a NW 3980 |0 (DE-625)132103: |2 rvk | ||
| 100 | 1 | |a Zuijderduijn, C. Jaco |e Verfasser |0 (DE-588)138494886 |4 aut | |
| 245 | 1 | 0 | |a Medieval capital markets |b markets for renten, state formation and private investment in Holland (1300 - 1550) |c by C. J. Zuijderduijn |
| 264 | 1 | |a Leiden [u.a.] |b Brill |c 2009 | |
| 300 | |a XII, 316 S. |b Ill., graph. Darst. | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 1 | |a Global economic history series |v 2 | |
| 500 | |a Includes bibliographical references and index | ||
| 648 | 7 | |a Geschichte 1300-1550 |2 gnd |9 rswk-swf | |
| 650 | 7 | |a Financiën |2 gtt | |
| 650 | 7 | |a Investeringen |2 gtt | |
| 650 | 7 | |a Kapitaalmarkt |2 gtt | |
| 650 | 4 | |a Geschichte | |
| 650 | 4 | |a Capital market |z Netherlands |x History |y To 1500 | |
| 650 | 4 | |a Finance |z Netherlands |x History |y To 1500 | |
| 650 | 0 | 7 | |a Kapitalmarkt |0 (DE-588)4029578-3 |2 gnd |9 rswk-swf |
| 651 | 7 | |a Nederland |2 gtt | |
| 651 | 4 | |a Niederlande | |
| 651 | 7 | |a Niederlande |0 (DE-588)4042203-3 |2 gnd |9 rswk-swf | |
| 689 | 0 | 0 | |a Niederlande |0 (DE-588)4042203-3 |D g |
| 689 | 0 | 1 | |a Kapitalmarkt |0 (DE-588)4029578-3 |D s |
| 689 | 0 | 2 | |a Geschichte 1300-1550 |A z |
| 689 | 0 | |5 DE-604 | |
| 830 | 0 | |a Global economic history series |v 2 |w (DE-604)BV035545705 |9 2 | |
| 856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=017601693&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 940 | 1 | |n DHB | |
| 940 | 1 | |q DHB_JDG_ISBN_1 | |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-017601693 | ||
| 942 | 1 | 1 | |c 330.09 |e 22/bsb |f 09031 |g 492 |
| 942 | 1 | 1 | |c 330.09 |e 22/bsb |f 09023 |g 492 |
| 942 | 1 | 1 | |c 330.09 |e 22/bsb |f 09024 |g 492 |
Datensatz im Suchindex
| _version_ | 1804139187823181824 |
|---|---|
| adam_text | Titel: Medieval capital markets
Autor: Zuijderduijn, C. Jaco
Jahr: 2009
CONTENTS
List of Tables ...................................................................................... vii
List of Illustrations ............................................................................ ix
Preface ................................................................................................. xi
Introduction ........................................................................................ 1
Medieval Capital Markets.............................................................. 5
Medieval Holland: Political Economy ....................................... 13
Historiography ............................................................................... 21
Research Questions ....................................................................... 24
Chapter One Central Government .............................................. 27
1.1 Establishing Sovereignty ..................................................... 28
1.2 Administration of Justice ................................................... 36
1.3 Economic Policy .................................................................. 52
1.4 Condusion ............................................................................ 68
Chapter Two State Formation, Institutional Change, and
Markets for Public Debt ............................................................... 71
2.1 The Limits of Comitial Credit: Floating Debt ................ 73
2.2 Tapping into Rieh Resources: Foreign Capital Markets
and the Creation of Funded Debt ..................................... 80
2.3 The Century of Public Debt ............................................... 94
2.4 Conclusion ............................................................................ 108
Chapter Three Public Interest: The Institutional Framework
of Markets for Public Debt .......................................................... 111
3.1 Good Institutions: The Organization of
Funded Debt ......................................................................... 112
3.2 Good Institutions: The Development of Personal
Execution ............................................................................... 117
3.3 Bad Institutions: Coping with Default ............................. 124
3.4 Conclusion ............................................................................ 137
Chapter Four The Emergence of Markets for Public Debt ..... 139
4.1 The Financial Nexus: Dordrecht....................................... 140
4.2 The Rise of Markets for Public Debt................................ 152
Vi CONTENTS
4.3 Geographie Diffusion of Public Debt ............................... 175
4.4 Conclusion ............................................................................ 181
Chapter Five The Institutional Framework of Markets for
Private Debt .................................................................................... 183
5.1 Local Courts as Pivotal Points in Economic
Exchange ................................................................................ 184
5.2 Public Bodies as Agents of Institutional Change ........... 191
5.3 Institutional Framework ..................................................... 199
5.4 Conclusion ............................................................................. 223
Chapter Six The Emergence of Markets for Private Debt ....... 227
6.1 Qualitative Aspects .............................................................. 228
6.2 Quantitative Aspects: renten in Edam and De Zeevang 232
6.3 Interest Rates ......................................................................... 242
6.4 Conclusion ............................................................................. 246
Chapter Seven Medieval Capital Markets in Northwest
Europe ............................................................................................. 249
7.1 Government Funding in Northwest Europe ................... 250
7.2 Markets for Public Debt in Northwest Europe ............... 252
7.3 Markets for Private Debt in Northwest Europe ............. 258
7.4 The Italian City-States and England ................................. 261
7.5 Conclusion ............................................................................. 267
Conclusion .......................................................................................... 269
State Formation ............................................................................. 269
Markets for Public Debt ............................................................... 271
Markets for Private Debt ............................................................. 275
A Medieval Legacy ........................................................................ 279
Appendix ............................................................................................. 283
References........................................................................................... 287
Index .................................................................................................... 309
LIST OF TABLES
1.1. Geographic origins of appeals at the Grote Raad
(1470-1534) ................................................................................ 45
1.2. Geographic origins of appeals at the Grote Raad
(1470-1534) ................................................................................ 45
1.3. Revenues from Lombards in the accounts of comitial
receivers (14th century) ............................................................ 58
2.1. Collective public debt (1292-1482) ........................................ 89
2.2. Collective public debt (1404-1425) ........................................ 97
2.3. Domestic and foreign markets for gemenelandsrenten
(1515-1565) ................................................................................ 106
4.1. Geographic dispersion of renten owed by Gouda
(1389-1397) ................................................................................ 157
4.2. Public debt in 1514 (six main cities) ..................................... 170
4.3. Public debt in 1514 (small towns) .......................................... 174
4.4. Rente payments per capita and interest rates in 1514 ........ 175
4.5. Geographic dispersion of Hjfrenten owed by Haarlem
(1428-1490) ................................................................................ 180
6.1. Funded debt in Edam and De Zeevang (1462) .................... 235
6.2. Funded debt in Edam and De Zeevang (1514) .................... 236
6.3. Funded debt in Edam and De Zeevang (1563) .................... 236
6.4. Rente payers in Edam and De Zeevang according to
gender .......................................................................................... 238
6.5. Taxation of rente payers in Edam and De Zeevang ............ 238
6.6. Renteniers in Edam and De Zeevang according to
gender .......................................................................................... 241
6.7. Taxation of renteniers in Edam and De Zeevang ................ 241
6.8. Average interest rates of losrenten in Edam and De
Zeevang (N) ................................................................................ 244
LIST OF ILLUSTRATIONS
Figures
2.1. Composition of comitial loans (1389-1433) ...................... 77
2.2. Interest rates of floating and funded debt contracted by
Charles V (1520-1556) ........................................................... 81
4.1. Public debt of Dordrecht (1285-1501) ................................ 150
4.2. Extraordinary revenues of Leiden (1413-1477) ................. 161
4.3. Rente payments of Leiden as a percentage of ordinary
revenues(1413-1556) ............................................................. 163
4.4. Rente payments of Haarlem as a percentage of ordinary
revenues(1428-1500) ............................................................. 164
4.5. Rente payments of Gouda as a percentage of ordinary
revenues(1437-1500) ............................................................. 165
4.6. Renten Gouda owed (1437-1500) ........................................ 165
4.7. Rente payments of Haarlem, Leiden and Gouda as a
percentage of ordinary revenues (1413-1547) ................... 166
4.8. Rente payments of Middelburg as a percentage of
ordinary revenues (1367-1500) ............................................ 168
4.9. Geographic dispersion of renteniers of Leiden
(1433-1548) .............................................................................. 178
4.10. Geographic dispersion of renteniers of Haarlem
(1420-1428) .............................................................................. 178
4.11. Geographic dispersion of renteniers of Haarlem
(1428-1490) .............................................................................. 179
6.1. Tax assessments of renteniers and rente payers in Edam
and De Zeevang ....................................................................... 239
6.2. Interest rates of losrenten in the private market for
renten ......................................................................................... 243
7.1. Average interest rates for the public debt of Haarlem
(1428-1490) .............................................................................. 257
X LIST OF ILLUSTRATIONS
Images
1. Townsmen of Utrecht submit to Count Willem IV after
the siege of 1345 (Nationaal Archief, Archief graven van
Holland, 1189-1660, inv. nr. 2149; Remissorium Philippi) .... 87
2. Printed ledger of renten Gouda owed (1490) (Streekarchief
Midden-Holland, Oud Archief Gouda inv. nr. 1047) ........... 118
3. Ledger of renten Dordrecht owed in Bruges (+/-1293-1294)
(Erfgoedcentrum DiEP, Stadsarchief: de grafelijke tijd,
inv. nr. 488) ................................................................................... 146
4. Rentebriefwith transfix (from 1369 and 1370, respectively)
(Streekarchief Midden-Holland, Archieven van de
gasthuizen (St. Catharinagasthuis, St. Elisabethgasthuis en
bestedelingenhuis), inv. nr. 228a/b) .......................................... 206
5. Maan- en klaagbrief (1493) (Regionaal Archief Zutphen,
Kaartencollectie Zutphen, inv. nr. 1956) ................................. 216
|
| any_adam_object | 1 |
| author | Zuijderduijn, C. Jaco |
| author_GND | (DE-588)138494886 |
| author_facet | Zuijderduijn, C. Jaco |
| author_role | aut |
| author_sort | Zuijderduijn, C. Jaco |
| author_variant | c j z cj cjz |
| building | Verbundindex |
| bvnumber | BV035545707 |
| callnumber-first | H - Social Science |
| callnumber-label | HG5562 |
| callnumber-raw | HG5562 |
| callnumber-search | HG5562 |
| callnumber-sort | HG 45562 |
| callnumber-subject | HG - Finance |
| classification_rvk | NW 2000 NW 3980 |
| ctrlnum | (OCoLC)312728523 (DE-599)BVBBV035545707 |
| dewey-full | 332/.041094920902 |
| dewey-hundreds | 300 - Social sciences |
| dewey-ones | 332 - Financial economics |
| dewey-raw | 332/.041094920902 |
| dewey-search | 332/.041094920902 |
| dewey-sort | 3332 1141094920902 |
| dewey-tens | 330 - Economics |
| discipline | Geschichte Wirtschaftswissenschaften |
| era | Geschichte 1300-1550 gnd |
| era_facet | Geschichte 1300-1550 |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>02322nam a2200613 cb4500</leader><controlfield tag="001">BV035545707</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20130327 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">090602s2009 xxuad|| |||| 00||| eng d</controlfield><datafield tag="010" ind1=" " ind2=" "><subfield code="a">2009007794</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9789004175655</subfield><subfield code="c">hardback : alk. paper</subfield><subfield code="9">978-90-04-17565-5</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)312728523</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV035545707</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">aacr</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">xxu</subfield><subfield code="c">US</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield><subfield code="a">DE-355</subfield><subfield code="a">DE-29</subfield><subfield code="a">DE-11</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">HG5562</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">332/.041094920902</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">NW 2000</subfield><subfield code="0">(DE-625)131968:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">NW 3980</subfield><subfield code="0">(DE-625)132103:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Zuijderduijn, C. Jaco</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)138494886</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Medieval capital markets</subfield><subfield code="b">markets for renten, state formation and private investment in Holland (1300 - 1550)</subfield><subfield code="c">by C. J. Zuijderduijn</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Leiden [u.a.]</subfield><subfield code="b">Brill</subfield><subfield code="c">2009</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">XII, 316 S.</subfield><subfield code="b">Ill., graph. Darst.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Global economic history series</subfield><subfield code="v">2</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references and index</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte 1300-1550</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Financiën</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Investeringen</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Kapitaalmarkt</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Geschichte</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Capital market</subfield><subfield code="z">Netherlands</subfield><subfield code="x">History</subfield><subfield code="y">To 1500</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Finance</subfield><subfield code="z">Netherlands</subfield><subfield code="x">History</subfield><subfield code="y">To 1500</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Kapitalmarkt</subfield><subfield code="0">(DE-588)4029578-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Nederland</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="651" ind1=" " ind2="4"><subfield code="a">Niederlande</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Niederlande</subfield><subfield code="0">(DE-588)4042203-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Niederlande</subfield><subfield code="0">(DE-588)4042203-3</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Kapitalmarkt</subfield><subfield code="0">(DE-588)4029578-3</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Geschichte 1300-1550</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Global economic history series</subfield><subfield code="v">2</subfield><subfield code="w">(DE-604)BV035545705</subfield><subfield code="9">2</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=017601693&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">DHB</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">DHB_JDG_ISBN_1</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-017601693</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">330.09</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09031</subfield><subfield code="g">492</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">330.09</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09023</subfield><subfield code="g">492</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">330.09</subfield><subfield code="e">22/bsb</subfield><subfield code="f">09024</subfield><subfield code="g">492</subfield></datafield></record></collection> |
| geographic | Nederland gtt Niederlande Niederlande (DE-588)4042203-3 gnd |
| geographic_facet | Nederland Niederlande |
| id | DE-604.BV035545707 |
| illustrated | Illustrated |
| indexdate | 2024-07-09T21:40:06Z |
| institution | BVB |
| isbn | 9789004175655 |
| language | English |
| lccn | 2009007794 |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-017601693 |
| oclc_num | 312728523 |
| open_access_boolean | |
| owner | DE-12 DE-355 DE-BY-UBR DE-29 DE-11 |
| owner_facet | DE-12 DE-355 DE-BY-UBR DE-29 DE-11 |
| physical | XII, 316 S. Ill., graph. Darst. |
| psigel | DHB_JDG_ISBN_1 |
| publishDate | 2009 |
| publishDateSearch | 2009 |
| publishDateSort | 2009 |
| publisher | Brill |
| record_format | marc |
| series | Global economic history series |
| series2 | Global economic history series |
| spelling | Zuijderduijn, C. Jaco Verfasser (DE-588)138494886 aut Medieval capital markets markets for renten, state formation and private investment in Holland (1300 - 1550) by C. J. Zuijderduijn Leiden [u.a.] Brill 2009 XII, 316 S. Ill., graph. Darst. txt rdacontent n rdamedia nc rdacarrier Global economic history series 2 Includes bibliographical references and index Geschichte 1300-1550 gnd rswk-swf Financiën gtt Investeringen gtt Kapitaalmarkt gtt Geschichte Capital market Netherlands History To 1500 Finance Netherlands History To 1500 Kapitalmarkt (DE-588)4029578-3 gnd rswk-swf Nederland gtt Niederlande Niederlande (DE-588)4042203-3 gnd rswk-swf Niederlande (DE-588)4042203-3 g Kapitalmarkt (DE-588)4029578-3 s Geschichte 1300-1550 z DE-604 Global economic history series 2 (DE-604)BV035545705 2 HBZ Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=017601693&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Zuijderduijn, C. Jaco Medieval capital markets markets for renten, state formation and private investment in Holland (1300 - 1550) Global economic history series Financiën gtt Investeringen gtt Kapitaalmarkt gtt Geschichte Capital market Netherlands History To 1500 Finance Netherlands History To 1500 Kapitalmarkt (DE-588)4029578-3 gnd |
| subject_GND | (DE-588)4029578-3 (DE-588)4042203-3 |
| title | Medieval capital markets markets for renten, state formation and private investment in Holland (1300 - 1550) |
| title_auth | Medieval capital markets markets for renten, state formation and private investment in Holland (1300 - 1550) |
| title_exact_search | Medieval capital markets markets for renten, state formation and private investment in Holland (1300 - 1550) |
| title_full | Medieval capital markets markets for renten, state formation and private investment in Holland (1300 - 1550) by C. J. Zuijderduijn |
| title_fullStr | Medieval capital markets markets for renten, state formation and private investment in Holland (1300 - 1550) by C. J. Zuijderduijn |
| title_full_unstemmed | Medieval capital markets markets for renten, state formation and private investment in Holland (1300 - 1550) by C. J. Zuijderduijn |
| title_short | Medieval capital markets |
| title_sort | medieval capital markets markets for renten state formation and private investment in holland 1300 1550 |
| title_sub | markets for renten, state formation and private investment in Holland (1300 - 1550) |
| topic | Financiën gtt Investeringen gtt Kapitaalmarkt gtt Geschichte Capital market Netherlands History To 1500 Finance Netherlands History To 1500 Kapitalmarkt (DE-588)4029578-3 gnd |
| topic_facet | Financiën Investeringen Kapitaalmarkt Geschichte Capital market Netherlands History To 1500 Finance Netherlands History To 1500 Kapitalmarkt Nederland Niederlande |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=017601693&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| volume_link | (DE-604)BV035545705 |
| work_keys_str_mv | AT zuijderduijncjaco medievalcapitalmarketsmarketsforrentenstateformationandprivateinvestmentinholland13001550 |