For the privileged few: Islamic miniature painting from the David Collection
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
Humlebæk
Louisiana Museum of Modern Art [u.a.]
2007
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | Ausstellungskatalog. - Publ. on the occasion of the exhibiton "For the privileged Few", October 9, 2007 - Januari 1, 2008. - Auch auf Dän. ersch. u.d.T.: : For de udvalgte få |
| Beschreibung: | 235 Seiten Illustrationen 33 cm |
| ISBN: | 9788791607141 8791607140 |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV035132902 | ||
| 003 | DE-604 | ||
| 005 | 20231107 | ||
| 007 | t | ||
| 008 | 081031s2007 a||| |||| 00||| eng d | ||
| 020 | |a 9788791607141 |9 978-87-91607-14-1 | ||
| 020 | |a 8791607140 |9 87-91607-14-0 | ||
| 020 | |z 9788791607097 |9 978-87-91607-09-7 | ||
| 035 | |a (OCoLC)183262813 | ||
| 035 | |a (DE-599)BVBBV035132902 | ||
| 040 | |a DE-604 |b ger |e rakwb | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-12 |a DE-473 |a DE-11 | ||
| 050 | 0 | |a ND2955 | |
| 082 | 0 | |a 745.67 |2 23 | |
| 084 | |a LH 65960 |0 (DE-625)94570: |2 rvk | ||
| 084 | |a LO 88332 |0 (DE-625)105122: |2 rvk | ||
| 100 | 1 | |a Folsach, Kjeld von |d 1950- |e Verfasser |0 (DE-588)1167882997 |4 aut | |
| 245 | 1 | 0 | |a For the privileged few |b Islamic miniature painting from the David Collection |c Kjeld von Folsach |
| 264 | 1 | |a Humlebæk |b Louisiana Museum of Modern Art [u.a.] |c 2007 | |
| 300 | |a 235 Seiten |b Illustrationen |c 33 cm | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 500 | |a Ausstellungskatalog. - Publ. on the occasion of the exhibiton "For the privileged Few", October 9, 2007 - Januari 1, 2008. - Auch auf Dän. ersch. u.d.T.: : For de udvalgte få | ||
| 610 | 1 | 4 | |a C. L. Davids fond og samling / Art collections / Exhibitions |
| 610 | 2 | 4 | |a C. L. Davids fond og samling |x Art collections |v Exhibitions |
| 610 | 2 | 7 | |a Davids Samling |g Kopenhagen |0 (DE-588)2087401-7 |2 gnd |9 rswk-swf |
| 650 | 4 | |a Miniature painting, Islamic / Exhibitions | |
| 650 | 4 | |a Illumination of books and manuscripts, Islamic / Exhibitions | |
| 650 | 4 | |a Islamic calligraphy / Exhibitions | |
| 650 | 4 | |a Art / Private collections / Denmark / Copenhagen / Exhibitions | |
| 650 | 4 | |a Illumination of books and manuscripts / Denmark / Copenhagen / Exhibitions | |
| 650 | 4 | |a Miniature painting / Denmark / Copenhagen / Exhibitions | |
| 650 | 4 | |a Kunst | |
| 650 | 4 | |a Art |x Private collections |z Denmark |z Copenhagen |v Exhibitions | |
| 650 | 4 | |a Illumination of books and manuscripts |z Denmark |z Copenhagen |x Exhibitions | |
| 650 | 4 | |a Islamic calligraphy |v Exhibitions | |
| 650 | 4 | |a Islamic illumination of books and manuscripts |v Exhibitions | |
| 650 | 4 | |a Islamic miniature painting |v Exhibitions | |
| 650 | 4 | |a Miniature painting |z Denmark |z Copenhagen |x Exhibitions | |
| 650 | 0 | 7 | |a Buchmalerei |0 (DE-588)4008650-1 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Miniatur |0 (DE-588)4170041-7 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Handschrift |0 (DE-588)4023287-6 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Islam |0 (DE-588)4027743-4 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Buchkunst |0 (DE-588)4008648-3 |2 gnd |9 rswk-swf |
| 651 | 4 | |a Dänemark | |
| 655 | 7 | |0 (DE-588)4135467-9 |a Ausstellungskatalog |y 2007-2008 |z Humlebaek |2 gnd-content | |
| 689 | 0 | 0 | |a Davids Samling |g Kopenhagen |0 (DE-588)2087401-7 |D b |
| 689 | 0 | 1 | |a Islam |0 (DE-588)4027743-4 |D s |
| 689 | 0 | 2 | |a Handschrift |0 (DE-588)4023287-6 |D s |
| 689 | 0 | 3 | |a Buchkunst |0 (DE-588)4008648-3 |D s |
| 689 | 0 | 4 | |a Buchmalerei |0 (DE-588)4008650-1 |D s |
| 689 | 0 | 5 | |a Miniatur |0 (DE-588)4170041-7 |D s |
| 689 | 0 | |5 DE-604 | |
| 689 | 1 | 0 | |a Davids Samling |g Kopenhagen |0 (DE-588)2087401-7 |D b |
| 689 | 1 | 1 | |a Islam |0 (DE-588)4027743-4 |D s |
| 689 | 1 | 2 | |a Buchkunst |0 (DE-588)4008648-3 |D s |
| 689 | 1 | 3 | |a Miniatur |0 (DE-588)4170041-7 |D s |
| 689 | 1 | |5 DE-604 | |
| 710 | 2 | |a Davids Samling (Kopenhagen) |e Sonstige |0 (DE-588)2087401-7 |4 oth | |
| 856 | 4 | 2 | |m Digitalisierung UB Bamberg - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=016800393&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-016800393 | ||
Datensatz im Suchindex
| _version_ | 1804138115609133056 |
|---|---|
| adam_text | Index
7
Foreword
9
Introduction
19
The Formative Period,
с
1200 -1500
69
The Classical Period,
с
1500 -1600
143
The New Age,
с.
1600-1750
209
Epilogue. The Late Period, after
с
1750
231
Selected Bibliography
232
Map of the Islamic World
234
Islamic Dynasties
|
| adam_txt |
Index
7
Foreword
9
Introduction
19
The Formative Period,
с
1200 -1500
69
The Classical Period,
с
1500 -1600
143
The New Age,
с.
1600-1750
209
Epilogue. The Late Period, after
с
1750
231
Selected Bibliography
232
Map of the Islamic World
234
Islamic Dynasties |
| any_adam_object | 1 |
| any_adam_object_boolean | 1 |
| author | Folsach, Kjeld von 1950- |
| author_GND | (DE-588)1167882997 |
| author_facet | Folsach, Kjeld von 1950- |
| author_role | aut |
| author_sort | Folsach, Kjeld von 1950- |
| author_variant | k v f kv kvf |
| building | Verbundindex |
| bvnumber | BV035132902 |
| callnumber-first | N - Fine Arts |
| callnumber-label | ND2955 |
| callnumber-raw | ND2955 |
| callnumber-search | ND2955 |
| callnumber-sort | ND 42955 |
| callnumber-subject | ND - Painting |
| classification_rvk | LH 65960 LO 88332 |
| ctrlnum | (OCoLC)183262813 (DE-599)BVBBV035132902 |
| dewey-full | 745.67 |
| dewey-hundreds | 700 - The arts |
| dewey-ones | 745 - Decorative arts |
| dewey-raw | 745.67 |
| dewey-search | 745.67 |
| dewey-sort | 3745.67 |
| dewey-tens | 740 - Graphic arts and decorative arts |
| discipline | Kunstgeschichte |
| discipline_str_mv | Kunstgeschichte |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>03678nam a2200781 c 4500</leader><controlfield tag="001">BV035132902</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20231107 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">081031s2007 a||| |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9788791607141</subfield><subfield code="9">978-87-91607-14-1</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">8791607140</subfield><subfield code="9">87-91607-14-0</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">9788791607097</subfield><subfield code="9">978-87-91607-09-7</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)183262813</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV035132902</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield><subfield code="a">DE-473</subfield><subfield code="a">DE-11</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">ND2955</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">745.67</subfield><subfield code="2">23</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">LH 65960</subfield><subfield code="0">(DE-625)94570:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">LO 88332</subfield><subfield code="0">(DE-625)105122:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Folsach, Kjeld von</subfield><subfield code="d">1950-</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1167882997</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">For the privileged few</subfield><subfield code="b">Islamic miniature painting from the David Collection</subfield><subfield code="c">Kjeld von Folsach</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Humlebæk</subfield><subfield code="b">Louisiana Museum of Modern Art [u.a.]</subfield><subfield code="c">2007</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">235 Seiten</subfield><subfield code="b">Illustrationen</subfield><subfield code="c">33 cm</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Ausstellungskatalog. - Publ. on the occasion of the exhibiton "For the privileged Few", October 9, 2007 - Januari 1, 2008. - Auch auf Dän. ersch. u.d.T.: : For de udvalgte få</subfield></datafield><datafield tag="610" ind1="1" ind2="4"><subfield code="a">C. L. Davids fond og samling / Art collections / Exhibitions</subfield></datafield><datafield tag="610" ind1="2" ind2="4"><subfield code="a">C. L. Davids fond og samling</subfield><subfield code="x">Art collections</subfield><subfield code="v">Exhibitions</subfield></datafield><datafield tag="610" ind1="2" ind2="7"><subfield code="a">Davids Samling</subfield><subfield code="g">Kopenhagen</subfield><subfield code="0">(DE-588)2087401-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Miniature painting, Islamic / Exhibitions</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Illumination of books and manuscripts, Islamic / Exhibitions</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Islamic calligraphy / Exhibitions</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Art / Private collections / Denmark / Copenhagen / Exhibitions</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Illumination of books and manuscripts / Denmark / Copenhagen / Exhibitions</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Miniature painting / Denmark / Copenhagen / Exhibitions</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Kunst</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Art</subfield><subfield code="x">Private collections</subfield><subfield code="z">Denmark</subfield><subfield code="z">Copenhagen</subfield><subfield code="v">Exhibitions</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Illumination of books and manuscripts</subfield><subfield code="z">Denmark</subfield><subfield code="z">Copenhagen</subfield><subfield code="x">Exhibitions</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Islamic calligraphy</subfield><subfield code="v">Exhibitions</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Islamic illumination of books and manuscripts</subfield><subfield code="v">Exhibitions</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Islamic miniature painting</subfield><subfield code="v">Exhibitions</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Miniature painting</subfield><subfield code="z">Denmark</subfield><subfield code="z">Copenhagen</subfield><subfield code="x">Exhibitions</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Buchmalerei</subfield><subfield code="0">(DE-588)4008650-1</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Miniatur</subfield><subfield code="0">(DE-588)4170041-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Handschrift</subfield><subfield code="0">(DE-588)4023287-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Islam</subfield><subfield code="0">(DE-588)4027743-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Buchkunst</subfield><subfield code="0">(DE-588)4008648-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="4"><subfield code="a">Dänemark</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)4135467-9</subfield><subfield code="a">Ausstellungskatalog</subfield><subfield code="y">2007-2008</subfield><subfield code="z">Humlebaek</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Davids Samling</subfield><subfield code="g">Kopenhagen</subfield><subfield code="0">(DE-588)2087401-7</subfield><subfield code="D">b</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Islam</subfield><subfield code="0">(DE-588)4027743-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Handschrift</subfield><subfield code="0">(DE-588)4023287-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Buchkunst</subfield><subfield code="0">(DE-588)4008648-3</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="4"><subfield code="a">Buchmalerei</subfield><subfield code="0">(DE-588)4008650-1</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="5"><subfield code="a">Miniatur</subfield><subfield code="0">(DE-588)4170041-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="1" ind2="0"><subfield code="a">Davids Samling</subfield><subfield code="g">Kopenhagen</subfield><subfield code="0">(DE-588)2087401-7</subfield><subfield code="D">b</subfield></datafield><datafield tag="689" ind1="1" ind2="1"><subfield code="a">Islam</subfield><subfield code="0">(DE-588)4027743-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="2"><subfield code="a">Buchkunst</subfield><subfield code="0">(DE-588)4008648-3</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="3"><subfield code="a">Miniatur</subfield><subfield code="0">(DE-588)4170041-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="710" ind1="2" ind2=" "><subfield code="a">Davids Samling (Kopenhagen)</subfield><subfield code="e">Sonstige</subfield><subfield code="0">(DE-588)2087401-7</subfield><subfield code="4">oth</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Bamberg - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=016800393&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-016800393</subfield></datafield></record></collection> |
| genre | (DE-588)4135467-9 Ausstellungskatalog 2007-2008 Humlebaek gnd-content |
| genre_facet | Ausstellungskatalog 2007-2008 Humlebaek |
| geographic | Dänemark |
| geographic_facet | Dänemark |
| id | DE-604.BV035132902 |
| illustrated | Illustrated |
| index_date | 2024-07-02T22:25:02Z |
| indexdate | 2024-07-09T21:23:04Z |
| institution | BVB |
| institution_GND | (DE-588)2087401-7 |
| isbn | 9788791607141 8791607140 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-016800393 |
| oclc_num | 183262813 |
| open_access_boolean | |
| owner | DE-12 DE-473 DE-BY-UBG DE-11 |
| owner_facet | DE-12 DE-473 DE-BY-UBG DE-11 |
| physical | 235 Seiten Illustrationen 33 cm |
| publishDate | 2007 |
| publishDateSearch | 2007 |
| publishDateSort | 2007 |
| publisher | Louisiana Museum of Modern Art [u.a.] |
| record_format | marc |
| spelling | Folsach, Kjeld von 1950- Verfasser (DE-588)1167882997 aut For the privileged few Islamic miniature painting from the David Collection Kjeld von Folsach Humlebæk Louisiana Museum of Modern Art [u.a.] 2007 235 Seiten Illustrationen 33 cm txt rdacontent n rdamedia nc rdacarrier Ausstellungskatalog. - Publ. on the occasion of the exhibiton "For the privileged Few", October 9, 2007 - Januari 1, 2008. - Auch auf Dän. ersch. u.d.T.: : For de udvalgte få C. L. Davids fond og samling / Art collections / Exhibitions C. L. Davids fond og samling Art collections Exhibitions Davids Samling Kopenhagen (DE-588)2087401-7 gnd rswk-swf Miniature painting, Islamic / Exhibitions Illumination of books and manuscripts, Islamic / Exhibitions Islamic calligraphy / Exhibitions Art / Private collections / Denmark / Copenhagen / Exhibitions Illumination of books and manuscripts / Denmark / Copenhagen / Exhibitions Miniature painting / Denmark / Copenhagen / Exhibitions Kunst Art Private collections Denmark Copenhagen Exhibitions Illumination of books and manuscripts Denmark Copenhagen Exhibitions Islamic calligraphy Exhibitions Islamic illumination of books and manuscripts Exhibitions Islamic miniature painting Exhibitions Miniature painting Denmark Copenhagen Exhibitions Buchmalerei (DE-588)4008650-1 gnd rswk-swf Miniatur (DE-588)4170041-7 gnd rswk-swf Handschrift (DE-588)4023287-6 gnd rswk-swf Islam (DE-588)4027743-4 gnd rswk-swf Buchkunst (DE-588)4008648-3 gnd rswk-swf Dänemark (DE-588)4135467-9 Ausstellungskatalog 2007-2008 Humlebaek gnd-content Davids Samling Kopenhagen (DE-588)2087401-7 b Islam (DE-588)4027743-4 s Handschrift (DE-588)4023287-6 s Buchkunst (DE-588)4008648-3 s Buchmalerei (DE-588)4008650-1 s Miniatur (DE-588)4170041-7 s DE-604 Davids Samling (Kopenhagen) Sonstige (DE-588)2087401-7 oth Digitalisierung UB Bamberg - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=016800393&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Folsach, Kjeld von 1950- For the privileged few Islamic miniature painting from the David Collection C. L. Davids fond og samling / Art collections / Exhibitions C. L. Davids fond og samling Art collections Exhibitions Davids Samling Kopenhagen (DE-588)2087401-7 gnd Miniature painting, Islamic / Exhibitions Illumination of books and manuscripts, Islamic / Exhibitions Islamic calligraphy / Exhibitions Art / Private collections / Denmark / Copenhagen / Exhibitions Illumination of books and manuscripts / Denmark / Copenhagen / Exhibitions Miniature painting / Denmark / Copenhagen / Exhibitions Kunst Art Private collections Denmark Copenhagen Exhibitions Illumination of books and manuscripts Denmark Copenhagen Exhibitions Islamic calligraphy Exhibitions Islamic illumination of books and manuscripts Exhibitions Islamic miniature painting Exhibitions Miniature painting Denmark Copenhagen Exhibitions Buchmalerei (DE-588)4008650-1 gnd Miniatur (DE-588)4170041-7 gnd Handschrift (DE-588)4023287-6 gnd Islam (DE-588)4027743-4 gnd Buchkunst (DE-588)4008648-3 gnd |
| subject_GND | (DE-588)2087401-7 (DE-588)4008650-1 (DE-588)4170041-7 (DE-588)4023287-6 (DE-588)4027743-4 (DE-588)4008648-3 (DE-588)4135467-9 |
| title | For the privileged few Islamic miniature painting from the David Collection |
| title_auth | For the privileged few Islamic miniature painting from the David Collection |
| title_exact_search | For the privileged few Islamic miniature painting from the David Collection |
| title_exact_search_txtP | For the privileged few Islamic miniature painting from the David Collection |
| title_full | For the privileged few Islamic miniature painting from the David Collection Kjeld von Folsach |
| title_fullStr | For the privileged few Islamic miniature painting from the David Collection Kjeld von Folsach |
| title_full_unstemmed | For the privileged few Islamic miniature painting from the David Collection Kjeld von Folsach |
| title_short | For the privileged few |
| title_sort | for the privileged few islamic miniature painting from the david collection |
| title_sub | Islamic miniature painting from the David Collection |
| topic | C. L. Davids fond og samling / Art collections / Exhibitions C. L. Davids fond og samling Art collections Exhibitions Davids Samling Kopenhagen (DE-588)2087401-7 gnd Miniature painting, Islamic / Exhibitions Illumination of books and manuscripts, Islamic / Exhibitions Islamic calligraphy / Exhibitions Art / Private collections / Denmark / Copenhagen / Exhibitions Illumination of books and manuscripts / Denmark / Copenhagen / Exhibitions Miniature painting / Denmark / Copenhagen / Exhibitions Kunst Art Private collections Denmark Copenhagen Exhibitions Illumination of books and manuscripts Denmark Copenhagen Exhibitions Islamic calligraphy Exhibitions Islamic illumination of books and manuscripts Exhibitions Islamic miniature painting Exhibitions Miniature painting Denmark Copenhagen Exhibitions Buchmalerei (DE-588)4008650-1 gnd Miniatur (DE-588)4170041-7 gnd Handschrift (DE-588)4023287-6 gnd Islam (DE-588)4027743-4 gnd Buchkunst (DE-588)4008648-3 gnd |
| topic_facet | C. L. Davids fond og samling / Art collections / Exhibitions C. L. Davids fond og samling Art collections Exhibitions Davids Samling Kopenhagen Miniature painting, Islamic / Exhibitions Illumination of books and manuscripts, Islamic / Exhibitions Islamic calligraphy / Exhibitions Art / Private collections / Denmark / Copenhagen / Exhibitions Illumination of books and manuscripts / Denmark / Copenhagen / Exhibitions Miniature painting / Denmark / Copenhagen / Exhibitions Kunst Art Private collections Denmark Copenhagen Exhibitions Illumination of books and manuscripts Denmark Copenhagen Exhibitions Islamic calligraphy Exhibitions Islamic illumination of books and manuscripts Exhibitions Islamic miniature painting Exhibitions Miniature painting Denmark Copenhagen Exhibitions Buchmalerei Miniatur Handschrift Islam Buchkunst Dänemark Ausstellungskatalog 2007-2008 Humlebaek |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=016800393&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT folsachkjeldvon fortheprivilegedfewislamicminiaturepaintingfromthedavidcollection AT davidssamlingkopenhagen fortheprivilegedfewislamicminiaturepaintingfromthedavidcollection |