Agglomeration, population size, and the cost of providing public services: an empirical analysis for German states
Gespeichert in:
| Hauptverfasser: | , , |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
Mannheim
Zentrum für Europ. Wirtschaftsforschung
2004
|
| Schriftenreihe: | Discussion paper / Centre for European Economic Research
04,18 : Public finance and corporate taxation |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | 16 S. graph. Darst. |
Internformat
MARC
| LEADER | 00000nam a2200000 cb4500 | ||
|---|---|---|---|
| 001 | BV024513780 | ||
| 003 | DE-604 | ||
| 005 | 20090910 | ||
| 007 | t | ||
| 008 | 090924s2004 d||| |||| 00||| eng d | ||
| 015 | |a 04,B16,0148 |2 dnb | ||
| 035 | |a (OCoLC)76693969 | ||
| 035 | |a (DE-599)BVBBV024513780 | ||
| 040 | |a DE-604 |b ger |e rakwb | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-83 | ||
| 100 | 1 | |a Büttner, Thies |e Verfasser |4 aut | |
| 245 | 1 | 0 | |a Agglomeration, population size, and the cost of providing public services |b an empirical analysis for German states |c Thiess Büttner, Robert Schwager and Dan Stegarescu |
| 264 | 1 | |a Mannheim |b Zentrum für Europ. Wirtschaftsforschung |c 2004 | |
| 300 | |a 16 S. |b graph. Darst. | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 1 | |a Discussion paper / Centre for European Economic Research |v 04,18 : Public finance and corporate taxation | |
| 700 | 1 | |a Schwager, Robert |e Verfasser |4 aut | |
| 700 | 1 | |a Stegarescu, Dan |e Verfasser |0 (DE-588)123179335 |4 aut | |
| 810 | 2 | |a Centre for European Economic Research |t Discussion paper |v 04,18 : Public finance and corporate taxation |w (DE-604)BV010838359 |9 04,18 | |
| 856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=018487956&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-018487956 | ||
Datensatz im Suchindex
| _version_ | 1804140514164867072 |
|---|---|
| adam_text | Discussion Paper No. 04-18
Agglomeration, Population Size, and the
Cost of Providing Public Services:
An Empirical Analysis for German States
Thiess Biittner, Robert Schwager and Dan Stegarescu
Download this ZEW Discussion Paper from our ftp server:
ftp://ftp.zew.de/pub/zew-docs/dp/dpOA18.pdf
Die D,scussion Papers dienen einer mogl.chst schnellen Verbremmg ™
neuerer, Forschungsarbeiten des ZEW Die Be.trage hegen ,n alle.mger Veranmortung
der Autoren und stellen mcht notwendigerweise d.e Memung des ZEW dar.
D1Scuss,on Papers are upended to make resu^rfZCT^e^h promptly ava.lable » other
economists „, orier to encourage dIScuss,on and suggesrions for rev,s,ons. The authors^solely
reSpons.ble for the contents which do not necessanly represent the opuuon of the ZfcW
|
| any_adam_object | 1 |
| author | Büttner, Thies Schwager, Robert Stegarescu, Dan |
| author_GND | (DE-588)123179335 |
| author_facet | Büttner, Thies Schwager, Robert Stegarescu, Dan |
| author_role | aut aut aut |
| author_sort | Büttner, Thies |
| author_variant | t b tb r s rs d s ds |
| building | Verbundindex |
| bvnumber | BV024513780 |
| ctrlnum | (OCoLC)76693969 (DE-599)BVBBV024513780 |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01460nam a2200313 cb4500</leader><controlfield tag="001">BV024513780</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20090910 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">090924s2004 d||| |||| 00||| eng d</controlfield><datafield tag="015" ind1=" " ind2=" "><subfield code="a">04,B16,0148</subfield><subfield code="2">dnb</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)76693969</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV024513780</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-83</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Büttner, Thies</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Agglomeration, population size, and the cost of providing public services</subfield><subfield code="b">an empirical analysis for German states</subfield><subfield code="c">Thiess Büttner, Robert Schwager and Dan Stegarescu</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Mannheim</subfield><subfield code="b">Zentrum für Europ. Wirtschaftsforschung</subfield><subfield code="c">2004</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">16 S.</subfield><subfield code="b">graph. Darst.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Discussion paper / Centre for European Economic Research</subfield><subfield code="v">04,18 : Public finance and corporate taxation</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Schwager, Robert</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Stegarescu, Dan</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)123179335</subfield><subfield code="4">aut</subfield></datafield><datafield tag="810" ind1="2" ind2=" "><subfield code="a">Centre for European Economic Research</subfield><subfield code="t">Discussion paper</subfield><subfield code="v">04,18 : Public finance and corporate taxation</subfield><subfield code="w">(DE-604)BV010838359</subfield><subfield code="9">04,18</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=018487956&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-018487956</subfield></datafield></record></collection> |
| id | DE-604.BV024513780 |
| illustrated | Illustrated |
| indexdate | 2024-07-09T22:01:11Z |
| institution | BVB |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-018487956 |
| oclc_num | 76693969 |
| open_access_boolean | |
| owner | DE-83 |
| owner_facet | DE-83 |
| physical | 16 S. graph. Darst. |
| publishDate | 2004 |
| publishDateSearch | 2004 |
| publishDateSort | 2004 |
| publisher | Zentrum für Europ. Wirtschaftsforschung |
| record_format | marc |
| series2 | Discussion paper / Centre for European Economic Research |
| spelling | Büttner, Thies Verfasser aut Agglomeration, population size, and the cost of providing public services an empirical analysis for German states Thiess Büttner, Robert Schwager and Dan Stegarescu Mannheim Zentrum für Europ. Wirtschaftsforschung 2004 16 S. graph. Darst. txt rdacontent n rdamedia nc rdacarrier Discussion paper / Centre for European Economic Research 04,18 : Public finance and corporate taxation Schwager, Robert Verfasser aut Stegarescu, Dan Verfasser (DE-588)123179335 aut Centre for European Economic Research Discussion paper 04,18 : Public finance and corporate taxation (DE-604)BV010838359 04,18 HBZ Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=018487956&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Büttner, Thies Schwager, Robert Stegarescu, Dan Agglomeration, population size, and the cost of providing public services an empirical analysis for German states |
| title | Agglomeration, population size, and the cost of providing public services an empirical analysis for German states |
| title_auth | Agglomeration, population size, and the cost of providing public services an empirical analysis for German states |
| title_exact_search | Agglomeration, population size, and the cost of providing public services an empirical analysis for German states |
| title_full | Agglomeration, population size, and the cost of providing public services an empirical analysis for German states Thiess Büttner, Robert Schwager and Dan Stegarescu |
| title_fullStr | Agglomeration, population size, and the cost of providing public services an empirical analysis for German states Thiess Büttner, Robert Schwager and Dan Stegarescu |
| title_full_unstemmed | Agglomeration, population size, and the cost of providing public services an empirical analysis for German states Thiess Büttner, Robert Schwager and Dan Stegarescu |
| title_short | Agglomeration, population size, and the cost of providing public services |
| title_sort | agglomeration population size and the cost of providing public services an empirical analysis for german states |
| title_sub | an empirical analysis for German states |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=018487956&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| volume_link | (DE-604)BV010838359 |
| work_keys_str_mv | AT buttnerthies agglomerationpopulationsizeandthecostofprovidingpublicservicesanempiricalanalysisforgermanstates AT schwagerrobert agglomerationpopulationsizeandthecostofprovidingpublicservicesanempiricalanalysisforgermanstates AT stegarescudan agglomerationpopulationsizeandthecostofprovidingpublicservicesanempiricalanalysisforgermanstates |