The new wealth of cities: city dynamics and the fifth wave
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
Aldershot [u.a.]
Ashgate
2007
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | Hier auch später erschienene, unveränderte Nachdrucke |
| Beschreibung: | XXVIII, 437 S. Ill., graph. Darst., Kt. |
| ISBN: | 9780754674153 9780754647898 |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV022371327 | ||
| 003 | DE-604 | ||
| 005 | 20140820 | ||
| 007 | t | ||
| 008 | 070329s2007 abd| |||| 00||| eng d | ||
| 020 | |a 9780754674153 |9 978-0-7546-7415-3 | ||
| 020 | |a 9780754647898 |9 978-0-7546-4789-8 | ||
| 035 | |a (OCoLC)238831516 | ||
| 035 | |a (DE-599)BVBBV022371327 | ||
| 040 | |a DE-604 |b ger |e rakwb | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-29 |a DE-12 |a DE-703 |a DE-634 | ||
| 082 | 1 | |a 307.1216 |2 22 | |
| 084 | |a RB 10909 |0 (DE-625)142220:12900 |2 rvk | ||
| 100 | 1 | |a Montgomery, John |e Verfasser |4 aut | |
| 245 | 1 | 0 | |a The new wealth of cities |b city dynamics and the fifth wave |c John Montgomery |
| 264 | 1 | |a Aldershot [u.a.] |b Ashgate |c 2007 | |
| 300 | |a XXVIII, 437 S. |b Ill., graph. Darst., Kt. | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 500 | |a Hier auch später erschienene, unveränderte Nachdrucke | ||
| 650 | 4 | |a Stadtplanung | |
| 650 | 4 | |a City planning | |
| 650 | 4 | |a Urban economics | |
| 650 | 0 | 7 | |a Wirtschaftsentwicklung |0 (DE-588)4066438-7 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Stadtentwicklung |0 (DE-588)4056730-8 |2 gnd |9 rswk-swf |
| 689 | 0 | 0 | |a Stadtentwicklung |0 (DE-588)4056730-8 |D s |
| 689 | 0 | 1 | |a Wirtschaftsentwicklung |0 (DE-588)4066438-7 |D s |
| 689 | 0 | |5 DE-604 | |
| 856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=015580490&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-015580490 | ||
Datensatz im Suchindex
| _version_ | 1804136424080932864 |
|---|---|
| adam_text | Contents
List of Figures ix
List of Tables xi
Acknowledgements xiii
Preface xvii
THEORY 1
TWO INTER LOCKING THEORIES OF CITY DEVELOPMENT
1. Death of the City? 1
2. A General Model of City Dynamics 3
3. The Long Waves of City Development 6
4. City Dynamics 11
Commerce 11
Culture 13
Built Form 15
Technology 18
Environment 24
Governance 25
Property Booms 27
5. Old Money and New Work 28
PART I: ECONOMY 31
THE NEW ECONOMY AND THE CREATIVE INDUSTRIES
1. The Economy of Cities 31
2. Knowledge Economies and Creative Cities 38
3. The Cultural or Creative Industries 43
Film and Television 62
The Music Industry 65
The Design Industries 67
4. The Rise of London s Creative Industries 1982 2002 68
5. The Creative Industries and the Fifth Wave 79
6. Developing the Creative Industries Locally 83
vi The New Wealth of Cities
PART II: CULTURE 91
ART AND THE CITY
1. Artistic Creativity 92
2. Art Movements as Paradigms 98
Composition 98
Literature 106
3. Cities and Artistic Creativity 113
Florence: Renaissance 113
Amsterdam: New Wealth and Old Masters 116
Edinburgh: Enlightenment 120
London and Paris: A Tale of Two Cities 125
New York: High Modernity 132
The Swinging Sixties 137
4. The Arts and Urban Regeneration 143
The Arts Come to Town 143
Manchester s Cultural Revival 148
5. Conclusion: Artistic Creativity and the Long Waves 163
PART III: TIME 171
... AND THE REGULATION OF PUBLIC MORALITY
On Time 172
1. Urban Social Life and the Evening Economy 178
Public Social Life 179
The Evening Economy 184
Bom to Binge? 187
2. Cities of the Night 193
London Entertained 193
Shanghai: The Whore of the East 201
Berlin 203
3. The Problem of Regulation: Case Studies 204
Amsterdam 204
Berlin 206
Paris 207
New York 208
Melbourne 210
Manchester 211
4. Future Forms of Regulation in the UK? 214
5. Time, Morality and the Long Wave 223
Contents vii
PART IV: PLACE 231
THE ART OF PLACE MAKING AND URBAN DESIGN
A New Kind of Mental Map? 231
1. Stories, Stones and Memories 232
2. Losing the Place 236
Still Sidmouth 240
3. City Design 245
Barcelona: A Tradition of City Building 245
Portland, Oregon: An Alternative Model for U.S. Cities 251
Marvellous Melbourne 253
Copenhagen 260
Lyon 264
4. Urban Design 267
Activity 271
Image 271
Form 272
City Making 275
5. Places in the Fifth Wave 290
PART V: CREATIVE MILIEUX 299
QUARTERS AND CLUSTERS
1. Creative Milieux 299
2. Cultural Quarters 304
Paris 310
SoHo 313
South Bank, London 314
Pittsburgh Triangle 320
3. Planned Cultural and Creative Industry Quarters 322
Temple Bar, Dublin 322
Sheffield Cultural Industries Quarter 329
Manchester Northern Quarter 333
Hindley Street, Adelaide 336
Wood Green Cultural Industries Quarter 339
Recent European Examples 342
4. A Typology for Developing Creative Quarters 346
5. Dynamic Creative Milieu in the Fifth Wave 358
viii The New Wealth of Cities
SUMMARY AND CONCLUSION 363
CITIES OF THE FIFTH WAVE
A Conclusion 363
Summary Argument 364
Fifth Wave Cities 368
Urban Planning in the Fifth Wave 371
Renaissance or Enlightenment? 379
Appendix A : City Night time Policy Frameworks 387
Appendix B: Cultural Quarters Evaluation Matrix Cultural Activity 401
Bibliography 417
Index 431
List of Figures
0.1 The Profit Cycle xix
0.2 City Dynamics 4
0.3 The Kondratieff Waves 7
0.4 London Estate Agents Advertising Poster for Prickett Ellis,
by Dudley Hardy (1901) 20
1.1 The Long Waves: Innovations and Industries 37
1.2 Total Employment in the Creative Industries, Australia (2001) 53
1.3 Creative Industries as a Proportion of All Industries, Australia (2001) 54
1.4 A Design Gallery Door, Barcelona 57
1.5 The Creative Industries Production Chain 59
1.6 A Group of Workers from Cubitt Co, constructing the
new Marconi factory in Chelmsford, Essex (1912) 72
1.7 West London Media Companies by Size 76
1.8 The West London Wedge 77
1.9 The Workstation, Sheffield CIQ 88
2.1 The Long Waves: Musical Composition 99
2.2 Design for a Keyboard (1792) 101
2.3 Nijinsky as the Faun, by L. Bakst (1912) 104
2.4 Claude Debussy with Igor Stravinsky (1910) 105
2.5 The Long Waves: Literature 107
2.6 The Old Masters 118
2.7 Amsterdam: Urban Form 120
2.8 Edinburgh: Urban Form 123
2.9 The Long Waves: Fine Art 133
2.10 Cultural Planning as an Holistic Approach 145
3.1 Time and Space 173
3.2 The King s Head, London 196
3.3 The Gay Parisienne, Duke of York s Theatre (1896) 199
3.4 Dry Bar, Manchester 212
3.5 Sunderland: Evening Economy Quarters 218
3.6 Strategy to Tackle All Night Disorder (STAND) 222
4.1 Barcelona: Urban Form 247
x The New Wealth of Cities
4.2 Placa del Pi, Barcelona 250
4.3 Portland: Urban Form 251
4.4 Melbourne: Urban Form 255
4.5 Melbourne CBD 256
4.6 Federation Square, Melbourne 259
4.7 Copenhagen: Urban Form 260
4.8 The Finger Plan Skitseforslag til Engsplan and
Storkobenhavn(1947) 262
4.9 Cafe Culture, Copenhagen 264
4.10 Lighting of the Public Realm, Lyons 266
4.11 A Visual Metaphor for the Nature of Places, by David Canter 269
4.12 Policy Directions to Foster an Urban Sense of Place 270
4.13 A Mental Map (Merchant City, Glasgow, 1994) 274
4.14 The Public Realm, Prague 278
4.15 Permeability 285
4.16 Plots and Building Lines 285
4.17 Vertical and Horizontal Grain 286
4.18 A Taxonomy for the Traditional Modern City 297
5.1 An Ideal Type Creative Industry Quarter 308
5.2 Courtyard Art, Le Marais 311
5.3 South Bank during the Festival of Britain, 1951 316
5.4 Oxo Wharf 318
5.5 Temple Bar Gallery and Studios, Dublin, 1990 323
5.6 Meeting House Square, Dublin 326
5.7 Temple Bar: Urban Form 327
5.8 Butcher Works, Sheffield CIQ 329
5.9 Sheffield CIQ: Development Strategy 331
5.10 Manchester Northern Quarter (MNQ): Urban Form 333
5.11 Underdale School of Art, Adelaide 337
5.12 The Chocolate Factory, Wood Green 340
5.13 Belfast Circus Space 350
5.14 Custard factory, Birmingham 353
5.15 Public Art, Temple Bar, Dublin, The Wounded King by
Ronan Halpin and Paki Smith 354
5.16 Area Branding, Temple Bar, Dublin (1993) 357
0.5 Cities: Winners and Losers 369
List of Tables
1.1 Knowledge Economy Activities 39
1.2 Creative Industries SIC92 Codes (UK) 45
1.3 Contribution of Creative Industries to Gross Value Added
(Gross Value Added, £ million) 47
1.4 Contribution of Creative Industries to Gross Value Added (% growth) 48
1.5 Exports of Creative Industries 48
1.6 Creative Employment 49
1.7 Numbers of VAT based Businesses in the Creative Industries 50
1.8 Market Size Industries of the Creative Economy
(billions of US dollars, 1999) 55
1.9 Audio visual Industries, London, 1992 70
1.10 Recorded Music Industry, London 1992 71
1.11 The Design Industries, London, 1992 71
1.12 Film Television and Video Industries, West London 1995 74
1.13 The Music Industry, West London 1995 74
1.14 Audio visual Industries by Company Size, West London 1995 75
1.15 Long wave Modes of Production Showing Typical Goods and Services 82
1.16 Policy Options for the Cultural Sector 86
1.17 An Ideal Type Media Industries Development Strategy 87
2.1 Strategic Dilemmas in City Cultural Policy 150
2.2 Strategic Urban Cultural Objectives 153
2.3 Manchester s Cultural Strategy 158
2.4 The Long Waves and Artistic Movements 165
2.5 The Long Waves and Modes of Production 168
3.1 Night life in English Cities, 1660 2004 226
3.2 Long wave Modes of Production Showing the Regulation
of Entertainment and Public Morality 229
4.1 Indicators of Successful Urban Places 268
4.2 Summary Principles for Achieving Urbanity 291
5.1 Indicators of Good Cultural Activity 307
5.2 Cultural Quarters: Necessary Conditions and Success Factors 309
5.3 Cities as Dynamic Creative Economies 359
|
| adam_txt |
Contents
List of Figures ix
List of Tables xi
Acknowledgements xiii
Preface xvii
THEORY 1
TWO INTER LOCKING THEORIES OF CITY DEVELOPMENT
1. Death of the City? 1
2. A General Model of City Dynamics 3
3. The Long Waves of City Development 6
4. City Dynamics 11
Commerce 11
Culture 13
Built Form 15
Technology 18
Environment 24
Governance 25
Property Booms 27
5. Old Money and New Work 28
PART I: ECONOMY 31
THE NEW ECONOMY AND THE CREATIVE INDUSTRIES
1. The Economy of Cities 31
2. Knowledge Economies and Creative Cities 38
3. The Cultural or Creative Industries 43
Film and Television 62
The Music Industry 65
The Design Industries 67
4. The Rise of London's Creative Industries 1982 2002 68
5. The Creative Industries and the Fifth Wave 79
6. Developing the Creative Industries Locally 83
vi The New Wealth of Cities
PART II: CULTURE 91
ART AND THE CITY
1. Artistic Creativity 92
2. Art Movements as Paradigms 98
Composition 98
Literature 106
3. Cities and Artistic Creativity 113
Florence: Renaissance 113
Amsterdam: New Wealth and Old Masters 116
Edinburgh: Enlightenment 120
London and Paris: A Tale of Two Cities 125
New York: High Modernity 132
The Swinging Sixties 137
4. The Arts and Urban Regeneration 143
The Arts Come to Town 143
Manchester's Cultural Revival 148
5. Conclusion: Artistic Creativity and the Long Waves 163
PART III: TIME 171
. AND THE REGULATION OF PUBLIC MORALITY
On Time 172
1. Urban Social Life and the Evening Economy 178
Public Social Life 179
The Evening Economy 184
Bom to Binge? 187
2. Cities of the Night 193
London Entertained 193
Shanghai: The Whore of the East 201
Berlin 203
3. The Problem of Regulation: Case Studies 204
Amsterdam 204
Berlin 206
Paris 207
New York 208
Melbourne 210
Manchester 211
4. Future Forms of Regulation in the UK? 214
5. Time, Morality and the Long Wave 223
Contents vii
PART IV: PLACE 231
THE ART OF PLACE MAKING AND URBAN DESIGN
A New Kind of Mental Map? 231
1. Stories, Stones and Memories 232
2. Losing the Place 236
Still Sidmouth 240
3. City Design 245
Barcelona: A Tradition of City Building 245
Portland, Oregon: An Alternative Model for U.S. Cities 251
Marvellous Melbourne 253
Copenhagen 260
Lyon 264
4. Urban Design 267
Activity 271
Image 271
Form 272
City Making 275
5. Places in the Fifth Wave 290
PART V: CREATIVE MILIEUX 299
QUARTERS AND CLUSTERS
1. Creative Milieux 299
2. Cultural Quarters 304
Paris 310
SoHo 313
South Bank, London 314
Pittsburgh Triangle 320
3. Planned Cultural and Creative Industry Quarters 322
Temple Bar, Dublin 322
Sheffield Cultural Industries Quarter 329
Manchester Northern Quarter 333
Hindley Street, Adelaide 336
Wood Green Cultural Industries Quarter 339
Recent European Examples 342
4. A Typology for Developing Creative Quarters 346
5. Dynamic Creative Milieu in the Fifth Wave 358
viii The New Wealth of Cities
SUMMARY AND CONCLUSION 363
CITIES OF THE FIFTH WAVE
A Conclusion 363
Summary Argument 364
Fifth Wave Cities 368
Urban Planning in the Fifth Wave 371
Renaissance or Enlightenment? 379
Appendix A : City Night time Policy Frameworks 387
Appendix B: Cultural Quarters Evaluation Matrix Cultural Activity 401
Bibliography 417
Index 431
List of Figures
0.1 The Profit Cycle xix
0.2 City Dynamics 4
0.3 The Kondratieff Waves 7
0.4 London Estate Agents Advertising Poster for Prickett Ellis,
by Dudley Hardy (1901) 20
1.1 The Long Waves: Innovations and Industries 37
1.2 Total Employment in the Creative Industries, Australia (2001) 53
1.3 Creative Industries as a Proportion of All Industries, Australia (2001) 54
1.4 A Design Gallery Door, Barcelona 57
1.5 The Creative Industries Production Chain 59
1.6 A Group of Workers from Cubitt Co, constructing the
new Marconi factory in Chelmsford, Essex (1912) 72
1.7 West London Media Companies by Size 76
1.8 The West London Wedge 77
1.9 The Workstation, Sheffield CIQ 88
2.1 The Long Waves: Musical Composition 99
2.2 Design for a Keyboard (1792) 101
2.3 Nijinsky as the Faun, by L. Bakst (1912) 104
2.4 Claude Debussy with Igor Stravinsky (1910) 105
2.5 The Long Waves: Literature 107
2.6 The Old Masters 118
2.7 Amsterdam: Urban Form 120
2.8 Edinburgh: Urban Form 123
2.9 The Long Waves: Fine Art 133
2.10 Cultural Planning as an Holistic Approach 145
3.1 Time and Space 173
3.2 The King's Head, London 196
3.3 The Gay Parisienne, Duke of York's Theatre (1896) 199
3.4 Dry Bar, Manchester 212
3.5 Sunderland: Evening Economy Quarters 218
3.6 Strategy to Tackle All Night Disorder (STAND) 222
4.1 Barcelona: Urban Form 247
x The New Wealth of Cities
4.2 Placa del Pi, Barcelona 250
4.3 Portland: Urban Form 251
4.4 Melbourne: Urban Form 255
4.5 Melbourne CBD 256
4.6 Federation Square, Melbourne 259
4.7 Copenhagen: Urban Form 260
4.8 "The Finger Plan" Skitseforslag til Engsplan and
Storkobenhavn(1947) 262
4.9 Cafe Culture, Copenhagen 264
4.10 Lighting of the Public Realm, Lyons 266
4.11 A Visual Metaphor for the Nature of Places, by David Canter 269
4.12 Policy Directions to Foster an Urban Sense of Place 270
4.13 A Mental Map (Merchant City, Glasgow, 1994) 274
4.14 The Public Realm, Prague 278
4.15 Permeability 285
4.16 Plots and Building Lines 285
4.17 Vertical and Horizontal Grain 286
4.18 A Taxonomy for the Traditional Modern City 297
5.1 An Ideal Type Creative Industry Quarter 308
5.2 Courtyard Art, Le Marais 311
5.3 South Bank during the Festival of Britain, 1951 316
5.4 Oxo Wharf 318
5.5 Temple Bar Gallery and Studios, Dublin, 1990 323
5.6 Meeting House Square, Dublin 326
5.7 Temple Bar: Urban Form 327
5.8 Butcher Works, Sheffield CIQ 329
5.9 Sheffield CIQ: Development Strategy 331
5.10 Manchester Northern Quarter (MNQ): Urban Form 333
5.11 Underdale School of Art, Adelaide 337
5.12 The Chocolate Factory, Wood Green 340
5.13 Belfast Circus Space 350
5.14 Custard factory, Birmingham 353
5.15 Public Art, Temple Bar, Dublin, The Wounded King by
Ronan Halpin and Paki Smith 354
5.16 Area Branding, Temple Bar, Dublin (1993) 357
0.5 Cities: Winners and Losers 369
List of Tables
1.1 Knowledge Economy Activities 39
1.2 Creative Industries SIC92 Codes (UK) 45
1.3 Contribution of Creative Industries to Gross Value Added
(Gross Value Added, £ million) 47
1.4 Contribution of Creative Industries to Gross Value Added (% growth) 48
1.5 Exports of Creative Industries 48
1.6 Creative Employment 49
1.7 Numbers of VAT based Businesses in the Creative Industries 50
1.8 Market Size Industries of the Creative Economy
(billions of US dollars, 1999) 55
1.9 Audio visual Industries, London, 1992 70
1.10 Recorded Music Industry, London 1992 71
1.11 The Design Industries, London, 1992 71
1.12 Film Television and Video Industries, West London 1995 74
1.13 The Music Industry, West London 1995 74
1.14 Audio visual Industries by Company Size, West London 1995 75
1.15 Long wave Modes of Production Showing Typical Goods and Services 82
1.16 Policy Options for the Cultural Sector 86
1.17 An Ideal Type Media Industries Development Strategy 87
2.1 Strategic Dilemmas in City Cultural Policy 150
2.2 Strategic Urban Cultural Objectives 153
2.3 Manchester's Cultural Strategy 158
2.4 The Long Waves and Artistic Movements 165
2.5 The Long Waves and Modes of Production 168
3.1 Night life in English Cities, 1660 2004 226
3.2 Long wave Modes of Production Showing the Regulation
of Entertainment and Public Morality 229
4.1 Indicators of Successful Urban Places 268
4.2 Summary Principles for Achieving Urbanity 291
5.1 Indicators of Good Cultural Activity 307
5.2 Cultural Quarters: Necessary Conditions and Success Factors 309
5.3 Cities as Dynamic Creative Economies 359 |
| any_adam_object | 1 |
| any_adam_object_boolean | 1 |
| author | Montgomery, John |
| author_facet | Montgomery, John |
| author_role | aut |
| author_sort | Montgomery, John |
| author_variant | j m jm |
| building | Verbundindex |
| bvnumber | BV022371327 |
| classification_rvk | RB 10909 |
| ctrlnum | (OCoLC)238831516 (DE-599)BVBBV022371327 |
| dewey-full | 307.1216 |
| dewey-hundreds | 300 - Social sciences |
| dewey-ones | 307 - Communities |
| dewey-raw | 307.1216 |
| dewey-search | 307.1216 |
| dewey-sort | 3307.1216 |
| dewey-tens | 300 - Social sciences |
| discipline | Soziologie Geographie |
| discipline_str_mv | Soziologie Geographie |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01597nam a2200409 c 4500</leader><controlfield tag="001">BV022371327</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20140820 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">070329s2007 abd| |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9780754674153</subfield><subfield code="9">978-0-7546-7415-3</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9780754647898</subfield><subfield code="9">978-0-7546-4789-8</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)238831516</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV022371327</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-29</subfield><subfield code="a">DE-12</subfield><subfield code="a">DE-703</subfield><subfield code="a">DE-634</subfield></datafield><datafield tag="082" ind1="1" ind2=" "><subfield code="a">307.1216</subfield><subfield code="2">22</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">RB 10909</subfield><subfield code="0">(DE-625)142220:12900</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Montgomery, John</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">The new wealth of cities</subfield><subfield code="b">city dynamics and the fifth wave</subfield><subfield code="c">John Montgomery</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Aldershot [u.a.]</subfield><subfield code="b">Ashgate</subfield><subfield code="c">2007</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">XXVIII, 437 S.</subfield><subfield code="b">Ill., graph. Darst., Kt.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Hier auch später erschienene, unveränderte Nachdrucke</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Stadtplanung</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">City planning</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Urban economics</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Wirtschaftsentwicklung</subfield><subfield code="0">(DE-588)4066438-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Stadtentwicklung</subfield><subfield code="0">(DE-588)4056730-8</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Stadtentwicklung</subfield><subfield code="0">(DE-588)4056730-8</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Wirtschaftsentwicklung</subfield><subfield code="0">(DE-588)4066438-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=015580490&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-015580490</subfield></datafield></record></collection> |
| id | DE-604.BV022371327 |
| illustrated | Illustrated |
| index_date | 2024-07-02T17:07:16Z |
| indexdate | 2024-07-09T20:56:10Z |
| institution | BVB |
| isbn | 9780754674153 9780754647898 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-015580490 |
| oclc_num | 238831516 |
| open_access_boolean | |
| owner | DE-29 DE-12 DE-703 DE-634 |
| owner_facet | DE-29 DE-12 DE-703 DE-634 |
| physical | XXVIII, 437 S. Ill., graph. Darst., Kt. |
| publishDate | 2007 |
| publishDateSearch | 2007 |
| publishDateSort | 2007 |
| publisher | Ashgate |
| record_format | marc |
| spelling | Montgomery, John Verfasser aut The new wealth of cities city dynamics and the fifth wave John Montgomery Aldershot [u.a.] Ashgate 2007 XXVIII, 437 S. Ill., graph. Darst., Kt. txt rdacontent n rdamedia nc rdacarrier Hier auch später erschienene, unveränderte Nachdrucke Stadtplanung City planning Urban economics Wirtschaftsentwicklung (DE-588)4066438-7 gnd rswk-swf Stadtentwicklung (DE-588)4056730-8 gnd rswk-swf Stadtentwicklung (DE-588)4056730-8 s Wirtschaftsentwicklung (DE-588)4066438-7 s DE-604 HBZ Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=015580490&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Montgomery, John The new wealth of cities city dynamics and the fifth wave Stadtplanung City planning Urban economics Wirtschaftsentwicklung (DE-588)4066438-7 gnd Stadtentwicklung (DE-588)4056730-8 gnd |
| subject_GND | (DE-588)4066438-7 (DE-588)4056730-8 |
| title | The new wealth of cities city dynamics and the fifth wave |
| title_auth | The new wealth of cities city dynamics and the fifth wave |
| title_exact_search | The new wealth of cities city dynamics and the fifth wave |
| title_exact_search_txtP | The new wealth of cities city dynamics and the fifth wave |
| title_full | The new wealth of cities city dynamics and the fifth wave John Montgomery |
| title_fullStr | The new wealth of cities city dynamics and the fifth wave John Montgomery |
| title_full_unstemmed | The new wealth of cities city dynamics and the fifth wave John Montgomery |
| title_short | The new wealth of cities |
| title_sort | the new wealth of cities city dynamics and the fifth wave |
| title_sub | city dynamics and the fifth wave |
| topic | Stadtplanung City planning Urban economics Wirtschaftsentwicklung (DE-588)4066438-7 gnd Stadtentwicklung (DE-588)4056730-8 gnd |
| topic_facet | Stadtplanung City planning Urban economics Wirtschaftsentwicklung Stadtentwicklung |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=015580490&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT montgomeryjohn thenewwealthofcitiescitydynamicsandthefifthwave |