Physical regulation of skeletal repair: [American Academy of Orthopaedic Surgeons, symposium]
Gespeichert in:
| Format: | Buch |
|---|---|
| Sprache: | English |
| Veröffentlicht: |
Rosemont, Ill.
Amer. Acad. of Orthopaedic Surgeons
2005
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | XV, 286 S. Ill., graph. Darst. |
| ISBN: | 0892033630 |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV020011202 | ||
| 003 | DE-604 | ||
| 005 | 20060407 | ||
| 007 | t | ||
| 008 | 050826s2005 ad|| |||| 10||| eng d | ||
| 020 | |a 0892033630 |9 0-89203-363-0 | ||
| 035 | |a (OCoLC)68980426 | ||
| 035 | |a (DE-599)BVBBV020011202 | ||
| 040 | |a DE-604 |b ger |e rakwb | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-355 | ||
| 050 | 0 | |a RD101 | |
| 082 | 0 | |a 617.5/5 |2 22 | |
| 245 | 1 | 0 | |a Physical regulation of skeletal repair |b [American Academy of Orthopaedic Surgeons, symposium] |c [ed. by Roy K. Aaron ...] |
| 264 | 1 | |a Rosemont, Ill. |b Amer. Acad. of Orthopaedic Surgeons |c 2005 | |
| 300 | |a XV, 286 S. |b Ill., graph. Darst. | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 650 | 4 | |a Bone Diseases |x therapy |v Congresses | |
| 650 | 4 | |a Fractures |x Treatment |v Congresses | |
| 650 | 4 | |a Fractures, Bone |x therapy |v Congresses | |
| 650 | 4 | |a Physical Stimulation |x methods |v Congresses | |
| 650 | 0 | 7 | |a Therapie |0 (DE-588)4059798-2 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Skelettkrankheit |0 (DE-588)4127495-7 |2 gnd |9 rswk-swf |
| 655 | 7 | |0 (DE-588)1071861417 |a Konferenzschrift |y 2003 |z Queenstown Md. |2 gnd-content | |
| 689 | 0 | 0 | |a Skelettkrankheit |0 (DE-588)4127495-7 |D s |
| 689 | 0 | 1 | |a Therapie |0 (DE-588)4059798-2 |D s |
| 689 | 0 | |C b |5 DE-604 | |
| 700 | 1 | |a Aaron, Roy K. |e Sonstige |4 oth | |
| 856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=013332754&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-013332754 | ||
Datensatz im Suchindex
| _version_ | 1804133567716917248 |
|---|---|
| adam_text | Physical Regulation of Skeletal Repair
Table of Contents
Preface xv
Section 1: Biophysical Regulation of Clinical Bone Healing
1 Clinical Results of Physical Techniques for Skeletal Repair 3
James T. Ryaby, PhD
2 Mechanical Regulation of Bone Healing 17
Allen Goodship, BVSc, PhD, MRCVS
3 Pulsed Low Intensity Ultrasound for Fracture Healing: 27
A Review of Clinical and In Vivo Evidence
R. Bruce Heppenstall, MD
4 Electric and Magnetic Stimulation of Bone Repair: 39
Review of the European Experience
Ruggero Cadossi, MD, Gian Carlo Traina, MD, Leo Massari, MD
Consensus Panel 1: Evaluation of Biophysical Regulation of 53
Clinical Bone Healing
Section 2: Biophysical Regulation of Bone Healing in
Animal Models
5 Bone s Preferred Strain History Provides Insight into 61
a Proposed Common Pathway for the Stimulation of
Bone Formation by Distinct Biophysical Signals
Clinton T. Rubin, PhD, Yi Xian Qin, PhD, Michael Hadjiargyrou, PhD,
Stefan Judex, PhD
6 Mechanical Regulation of Bone Repair 77
Lutz Claes, PhD, Peter Augat, PhD
7 Pulsed Low Intensity Ultrasound and Fracture Healing: 85
A Proposed Mechanism of Action
Javad Parvizi, MD, Sue J. Harris, PhD, Neill M. Pounder, PhD
8 Pulsed Electromagnetic Fields on Osteotomy Healing 97
and Normal Bone Turnover
Edmund Chao, PhD, Isao Ohnishi, MD, Bahman Rafiee, MD,
Rainer Meffert, MD, Teresa Wu, MD, Dennis Cullinane, PhD,
Bruce Simon, PhD, Nozomu Inoue, MD, PhD
Consensus Panel 2: Evaluation of Biophysical Regulation of 111
Bone Healing in Animal Models
American Academy of Orthopaedic Surgeons xi
Physical Regulation of Skeletal Repair
Section 3: Biophysical Regulation of Skeletal Cells and Tissues
9 Biophysical Regulation of Cell and Tissue Function 119
Alan J. Grodzinsky, ScD, Jon Szafranski, MS,
Michael DiMicco, PhD, Nora Szasz, PhD
10 Mechanical Regulation of Osteocyte Function 131
Jenneke Klein Nulend, PhD, Peter J. Nijweide, PhD,
Elisabeth H. Burger, PhD
11 Mechanical Signals Repress Osteoclast Formation In Vitro 143
Janet Rubin, MD, Xian Fan, MD
12 Chemomechanical Coupling in Articular Cartilage: IL la 151
and TGF Pj Regulate Chondrocyte Synthesis and Secretion
of Proteoglycan 4
Tannin A. Schmidt, MS, Barbara L. Schumacher, BS, Eun Hee Han, BS,
Travis J. Klein, MS, Michael S. Voegtline, PhD, Robert L. Sah, MD, ScD
Consensus Panel 3: Evaluation of Biophysical Regulation of 163
Skeletal Cells and Tissues
Section 4: Biophysical Regulation of Growth Factor Synthesis
13 Stimulation of Growth Factors by Physical Agents: 173
An Intermediary Mechanism of Action
Deborah McK. Ciombor, PhD
14 Mechanical Loading and Growth Factor Effects on 185
Connective Tissue Metabolism
R. Lane Smith, PhD
15 EMF Regulates Growth Factor Synthesis by Osteoblasts 201
Barbara D. Boyan, PhD, Bruce J. Simon, PhD, Jean C. Gan, PhD, Mary J.
MacDougall, PhD, Christoph H. Lohmann, MD, Zvi Schwartz, DMD, PhD
16 The Role of Genetics in Skeletal Mechanotransduction 209
Charles H. Turner, PhD
Consensus Panel 4: Evaluation of Biophysical Regulation of 217
Growth Factor Synthesis
Section 5: Transduction of Biophysical Signals
17 Transduction of Physical Signals in Articular Cartilage 225
Farshid Guilak, PhD, Lori A. Setton, PhD
18 Common Cellular Signaling Mechanisms for 241
Mechanotransduction
Jameel Iqbal, BS, Mone Zaidi, MD, PhD, FRCP
19 Calcium Signaling in Osteoblasts in Response to 247
Mechanical Stimulation
Randall L. Duncan, PhD, Damian C. Genetos, PhD
xii American Academy of Orthopaedic Surgeons
Physical Regulation of Skeletal Repair
20 Effect of Low Frequency Electromagnetic Fields on 259
A2A and A3 Adenosine Receptors in Human Neutrophils
Pier Andrea Borea, PhD, Katia Varani, PhD, Stefania Gessi, PhD,
Stefania Merighi, PhD, Valeria lannotta, MSc, Elena Cattabriga, PhD,
Cecilia Pancaldi, PhD, Ruggero Cadossi, MD
Consensus Panel 5: Evaluation of Trans duction of 269
Biophysical Signals
Index 277
American Academy of Orthopaedic Surgeons xiii
|
| any_adam_object | 1 |
| building | Verbundindex |
| bvnumber | BV020011202 |
| callnumber-first | R - Medicine |
| callnumber-label | RD101 |
| callnumber-raw | RD101 |
| callnumber-search | RD101 |
| callnumber-sort | RD 3101 |
| callnumber-subject | RD - Surgery |
| ctrlnum | (OCoLC)68980426 (DE-599)BVBBV020011202 |
| dewey-full | 617.5/5 |
| dewey-hundreds | 600 - Technology (Applied sciences) |
| dewey-ones | 617 - Surgery & related medical specialties |
| dewey-raw | 617.5/5 |
| dewey-search | 617.5/5 |
| dewey-sort | 3617.5 15 |
| dewey-tens | 610 - Medicine and health |
| discipline | Medizin |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01652nam a2200409 c 4500</leader><controlfield tag="001">BV020011202</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20060407 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">050826s2005 ad|| |||| 10||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">0892033630</subfield><subfield code="9">0-89203-363-0</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)68980426</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV020011202</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-355</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">RD101</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">617.5/5</subfield><subfield code="2">22</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Physical regulation of skeletal repair</subfield><subfield code="b">[American Academy of Orthopaedic Surgeons, symposium]</subfield><subfield code="c">[ed. by Roy K. Aaron ...]</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Rosemont, Ill.</subfield><subfield code="b">Amer. Acad. of Orthopaedic Surgeons</subfield><subfield code="c">2005</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">XV, 286 S.</subfield><subfield code="b">Ill., graph. Darst.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Bone Diseases</subfield><subfield code="x">therapy</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Fractures</subfield><subfield code="x">Treatment</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Fractures, Bone</subfield><subfield code="x">therapy</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Physical Stimulation</subfield><subfield code="x">methods</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Therapie</subfield><subfield code="0">(DE-588)4059798-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Skelettkrankheit</subfield><subfield code="0">(DE-588)4127495-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)1071861417</subfield><subfield code="a">Konferenzschrift</subfield><subfield code="y">2003</subfield><subfield code="z">Queenstown Md.</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Skelettkrankheit</subfield><subfield code="0">(DE-588)4127495-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Therapie</subfield><subfield code="0">(DE-588)4059798-2</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="C">b</subfield><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Aaron, Roy K.</subfield><subfield code="e">Sonstige</subfield><subfield code="4">oth</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=013332754&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-013332754</subfield></datafield></record></collection> |
| genre | (DE-588)1071861417 Konferenzschrift 2003 Queenstown Md. gnd-content |
| genre_facet | Konferenzschrift 2003 Queenstown Md. |
| id | DE-604.BV020011202 |
| illustrated | Illustrated |
| indexdate | 2024-07-09T20:10:46Z |
| institution | BVB |
| isbn | 0892033630 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-013332754 |
| oclc_num | 68980426 |
| open_access_boolean | |
| owner | DE-355 DE-BY-UBR |
| owner_facet | DE-355 DE-BY-UBR |
| physical | XV, 286 S. Ill., graph. Darst. |
| publishDate | 2005 |
| publishDateSearch | 2005 |
| publishDateSort | 2005 |
| publisher | Amer. Acad. of Orthopaedic Surgeons |
| record_format | marc |
| spelling | Physical regulation of skeletal repair [American Academy of Orthopaedic Surgeons, symposium] [ed. by Roy K. Aaron ...] Rosemont, Ill. Amer. Acad. of Orthopaedic Surgeons 2005 XV, 286 S. Ill., graph. Darst. txt rdacontent n rdamedia nc rdacarrier Bone Diseases therapy Congresses Fractures Treatment Congresses Fractures, Bone therapy Congresses Physical Stimulation methods Congresses Therapie (DE-588)4059798-2 gnd rswk-swf Skelettkrankheit (DE-588)4127495-7 gnd rswk-swf (DE-588)1071861417 Konferenzschrift 2003 Queenstown Md. gnd-content Skelettkrankheit (DE-588)4127495-7 s Therapie (DE-588)4059798-2 s b DE-604 Aaron, Roy K. Sonstige oth HBZ Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=013332754&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Physical regulation of skeletal repair [American Academy of Orthopaedic Surgeons, symposium] Bone Diseases therapy Congresses Fractures Treatment Congresses Fractures, Bone therapy Congresses Physical Stimulation methods Congresses Therapie (DE-588)4059798-2 gnd Skelettkrankheit (DE-588)4127495-7 gnd |
| subject_GND | (DE-588)4059798-2 (DE-588)4127495-7 (DE-588)1071861417 |
| title | Physical regulation of skeletal repair [American Academy of Orthopaedic Surgeons, symposium] |
| title_auth | Physical regulation of skeletal repair [American Academy of Orthopaedic Surgeons, symposium] |
| title_exact_search | Physical regulation of skeletal repair [American Academy of Orthopaedic Surgeons, symposium] |
| title_full | Physical regulation of skeletal repair [American Academy of Orthopaedic Surgeons, symposium] [ed. by Roy K. Aaron ...] |
| title_fullStr | Physical regulation of skeletal repair [American Academy of Orthopaedic Surgeons, symposium] [ed. by Roy K. Aaron ...] |
| title_full_unstemmed | Physical regulation of skeletal repair [American Academy of Orthopaedic Surgeons, symposium] [ed. by Roy K. Aaron ...] |
| title_short | Physical regulation of skeletal repair |
| title_sort | physical regulation of skeletal repair american academy of orthopaedic surgeons symposium |
| title_sub | [American Academy of Orthopaedic Surgeons, symposium] |
| topic | Bone Diseases therapy Congresses Fractures Treatment Congresses Fractures, Bone therapy Congresses Physical Stimulation methods Congresses Therapie (DE-588)4059798-2 gnd Skelettkrankheit (DE-588)4127495-7 gnd |
| topic_facet | Bone Diseases therapy Congresses Fractures Treatment Congresses Fractures, Bone therapy Congresses Physical Stimulation methods Congresses Therapie Skelettkrankheit Konferenzschrift 2003 Queenstown Md. |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=013332754&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT aaronroyk physicalregulationofskeletalrepairamericanacademyoforthopaedicsurgeonssymposium |