Security of supply in electricity markets: evidence and policy issues
Gespeichert in:
| Hauptverfasser: | , |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
Paris
OECD [u.a.]
2002
|
| Schriftenreihe: | Energy market reform
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | Includes bibliographical references (p. 167-172) |
| Beschreibung: | 172 S. graph. Darst., Kt. : 23 cm |
| ISBN: | 9264198059 |
Internformat
MARC
| LEADER | 00000nam a2200000zc 4500 | ||
|---|---|---|---|
| 001 | BV016877112 | ||
| 003 | DE-604 | ||
| 005 | 20030610 | ||
| 007 | t | ||
| 008 | 030305s2002 fr bd|| ||||z00||| eng d | ||
| 010 | |a 2003402167 | ||
| 020 | |a 9264198059 |9 92-64-19805-9 | ||
| 035 | |a (OCoLC)50213132 | ||
| 035 | |a (DE-599)BVBBV016877112 | ||
| 040 | |a DE-604 |b ger |e aacr | ||
| 041 | 0 | |a eng | |
| 044 | |a fr |c FR | ||
| 049 | |a DE-12 | ||
| 050 | 0 | |a HD9685.A2 | |
| 082 | 0 | |a 333.793211 |2 21 | |
| 100 | 1 | |a Ocaña, Carlos |e Verfasser |4 aut | |
| 245 | 1 | 0 | |a Security of supply in electricity markets |b evidence and policy issues |c [the authors of this book are Carlos Ocaña and Aurélie Hariton] |
| 264 | 1 | |a Paris |b OECD [u.a.] |c 2002 | |
| 300 | |a 172 S. |b graph. Darst., Kt. : 23 cm | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 0 | |a Energy market reform | |
| 500 | |a Includes bibliographical references (p. 167-172) | ||
| 610 | 2 | 7 | |a OECD |0 (DE-588)5157-3 |2 gnd |9 rswk-swf |
| 650 | 7 | |a Elektriciteitsopwekking |2 gtt | |
| 650 | 7 | |a Elektriciteitsverbruik |2 gtt | |
| 650 | 7 | |a Elektriciteitsvoorziening |2 gtt | |
| 650 | 7 | |a Leveranties |2 gtt | |
| 650 | 7 | |a Liberalisatie |2 gtt | |
| 650 | 7 | |a Zekerheid |2 gtt | |
| 650 | 4 | |a Electric power distribution | |
| 650 | 4 | |a Electric power |x Economic aspects | |
| 650 | 4 | |a Electric utilities |x Management | |
| 650 | 4 | |a Energy policy | |
| 650 | 0 | 7 | |a Energiepolitik |0 (DE-588)4014715-0 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Elektrizitätsmarkt |0 (DE-588)4328181-3 |2 gnd |9 rswk-swf |
| 689 | 0 | 0 | |a OECD |0 (DE-588)5157-3 |D b |
| 689 | 0 | 1 | |a Elektrizitätsmarkt |0 (DE-588)4328181-3 |D s |
| 689 | 0 | 2 | |a Energiepolitik |0 (DE-588)4014715-0 |D s |
| 689 | 0 | |5 DE-604 | |
| 700 | 1 | |a Hariton, Aurélie |e Verfasser |4 aut | |
| 856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=010239359&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-010239359 | ||
Datensatz im Suchindex
| _version_ | 1804129876906606592 |
|---|---|
| adam_text | TABLE OF CONTENTS
II INTRODUCTION 9
0BACKGROUND: ISSUES, TRENDS
AND POLICIES VS
Investment Decisions: a Primer 15
Problems in the Investment Performance
of Electricity Markets 17
Policy Tools: Capacity Mechanisms and Price Caps 20
Trends in IEA Countries 22
B GENERATION 27
Investment, Reserves and Fuel Mix in Liberalised Markets 28
Role of Prices and Market Structure 32
Impact of Policies and Regulations on Investment 35
Role of Governments 37
A Look Forward 40
H TRANSMISSION 45
Introduction 45
Current Investment Needs 51
Options to Relieve Transmission Congestion 58
Cross border Interconnections 64
Long term Issues in Transmission Investment:
Planning, Development and Ownership 71
BCASE STUDIES 83
The United Kingdom 84
Norway and Sweden 101
Australia 121
California 136
The Pennsylvania New Jersey Maryland Power Pool 155
6
REFERENCES 1_67
STATISTICAL AND LEGAL
REFERENCES 121
LIST OF FIGURES
1. Reserve Margins in IEA Countries 1985 1999 22
2. Electricity Generation Capacity by Fuel IEA Total 24
3. Generating Capacity Mix IEA Total 25
4. Reserve Margins in Selected Power Markets 29
5. Cost Shares of Electricity Supply 50
6. Electricity Exports (Billion kWh) 51
7. Inter regional Links between Australian National Electricity Market
Regions (1999) 53
8. Market Fragmentation in the EU
9. Transmission Capacity and Peak load in Japan (MW) 56
10. Growth Rates in Transmission Capacity and Summer Peak Demand 58
11. Ownership and Operation of Transmission in the EU 75
12. Models of Transmission Organisation 75
13. Shares of Generation Output in England and Wales 86
14. Demand and Generation Capacity in the UK, 1985 2000 96
15. Capacity Utilisation in the UK, 1985 2000 96
16. Reserve Margin and Demand Growth in the UK, 1986 2000 97
17. Generation Mix in the UK, 1985 2000 98
18. Wholesale Prices and Generation Capacity Change, 1990 2000 98
19. Retail Electricity Prices in the UK, 1985 2000 99
20. Generation Capacity and Demand in Norway, 1985 2000 1 13
2J. Generation Capacity and Demand in Sweden, 1985 2000 4
22. Capacity Utilisation in Norway and Sweden, 1985 2000 1 14
23. Fuel Mix in Norway, 1985 2000 6
24. Fuel Mix in Sweden, 1990 2000 116
25. Reserve Margins and Demand Growth in Norway, 1985 2000 117
26. Reserve Margins and Demand Growth in Sweden, 1985 2000 1 17
27. Spot Prices in Nord Pool, 1994 2001 119
28. National Bodies Involved in the Regulation of the Electricity
Market and their Main Functions 125
29. Installed Generation Capacity and Electricity Demand in the NEM,
1990 2000 131
30. Generation Capacity in the NEM States (MW), 1990 2000 131
31. Capacity Utilisation in the NEM 132
32. Reserve Margins in the NEM States, 1990 2000 133
33. Average Electricity Retail Prices in Australia, 1989 2000 134
34. Total Average Electricity Retail Prices in NEM States, 1989 2001 134
35. Capacity and Demand in California, 1990 2000 150
36. Capacity Utilisation in California, 1990 2000 150
37. Reserve Margin and Demand Growth in California, 1990 2000 15 1
38. Fuel Mix in California, 1990 2000 151
39. California PX Day Ahead and ISO Prices 152
40. Retail Prices in California, 1990 2000 152
41. Capacity Utilisation in Pennsylvania, 1990 2000 161
42. Reserve Margins and Capacity in PJM, 1995 2000 161
43. Fuel Mix in Pennsylvania, 1990 2000 162
44. Wholesale Price in PJM and Volatility, 1998 2000 162
45. Retail Prices in Pennsylvania, 1990 2000 164
LIST OF TABLES
1. Reserve Margins in IEA Countries 23
2. Change in Reserve Margins in the Reformed Markets 30
3. Investment Activity in Liberalised Markets
(Annual Change in Generating Capacity up to 2000) 3 1
4. Growth of Gas fired Generation 32
5. Wholesale Prices and Entry Costs 33
6. The Potential of Demand Side Measures: California 4 1
7. Examples of the Organisation of Transmission in IEA Countries 76
8. Existing Interconnections in 2000 02
9. Largest Nordic Electricity Generators in 2000 105
10. Overview of Generation Market Structure, 1999 123
11. Interconnection and Trade within the NEM, 2000 124
12. Regulatory Agencies in the States and Territories 125
13. Reserve Requirements in the National Electricity Market 128
14. Major Generators in California 140
15. Major Generating Companies in PJM 156
16. Installed Capacity Traded in the PJM Capacity Credit Market ($/MW) 164
|
| any_adam_object | 1 |
| author | Ocaña, Carlos Hariton, Aurélie |
| author_facet | Ocaña, Carlos Hariton, Aurélie |
| author_role | aut aut |
| author_sort | Ocaña, Carlos |
| author_variant | c o co a h ah |
| building | Verbundindex |
| bvnumber | BV016877112 |
| callnumber-first | H - Social Science |
| callnumber-label | HD9685 |
| callnumber-raw | HD9685.A2 |
| callnumber-search | HD9685.A2 |
| callnumber-sort | HD 49685 A2 |
| callnumber-subject | HD - Industries, Land Use, Labor |
| ctrlnum | (OCoLC)50213132 (DE-599)BVBBV016877112 |
| dewey-full | 333.793211 |
| dewey-hundreds | 300 - Social sciences |
| dewey-ones | 333 - Economics of land and energy |
| dewey-raw | 333.793211 |
| dewey-search | 333.793211 |
| dewey-sort | 3333.793211 |
| dewey-tens | 330 - Economics |
| discipline | Wirtschaftswissenschaften |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>02060nam a2200553zc 4500</leader><controlfield tag="001">BV016877112</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20030610 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">030305s2002 fr bd|| ||||z00||| eng d</controlfield><datafield tag="010" ind1=" " ind2=" "><subfield code="a">2003402167</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9264198059</subfield><subfield code="9">92-64-19805-9</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)50213132</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV016877112</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">aacr</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">fr</subfield><subfield code="c">FR</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">HD9685.A2</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">333.793211</subfield><subfield code="2">21</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Ocaña, Carlos</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Security of supply in electricity markets</subfield><subfield code="b">evidence and policy issues</subfield><subfield code="c">[the authors of this book are Carlos Ocaña and Aurélie Hariton]</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Paris</subfield><subfield code="b">OECD [u.a.]</subfield><subfield code="c">2002</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">172 S.</subfield><subfield code="b">graph. Darst., Kt. : 23 cm</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="0" ind2=" "><subfield code="a">Energy market reform</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references (p. 167-172)</subfield></datafield><datafield tag="610" ind1="2" ind2="7"><subfield code="a">OECD</subfield><subfield code="0">(DE-588)5157-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Elektriciteitsopwekking</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Elektriciteitsverbruik</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Elektriciteitsvoorziening</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Leveranties</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Liberalisatie</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Zekerheid</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Electric power distribution</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Electric power</subfield><subfield code="x">Economic aspects</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Electric utilities</subfield><subfield code="x">Management</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Energy policy</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Energiepolitik</subfield><subfield code="0">(DE-588)4014715-0</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Elektrizitätsmarkt</subfield><subfield code="0">(DE-588)4328181-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">OECD</subfield><subfield code="0">(DE-588)5157-3</subfield><subfield code="D">b</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Elektrizitätsmarkt</subfield><subfield code="0">(DE-588)4328181-3</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Energiepolitik</subfield><subfield code="0">(DE-588)4014715-0</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Hariton, Aurélie</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=010239359&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-010239359</subfield></datafield></record></collection> |
| id | DE-604.BV016877112 |
| illustrated | Illustrated |
| indexdate | 2024-07-09T19:12:07Z |
| institution | BVB |
| isbn | 9264198059 |
| language | English |
| lccn | 2003402167 |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-010239359 |
| oclc_num | 50213132 |
| open_access_boolean | |
| owner | DE-12 |
| owner_facet | DE-12 |
| physical | 172 S. graph. Darst., Kt. : 23 cm |
| publishDate | 2002 |
| publishDateSearch | 2002 |
| publishDateSort | 2002 |
| publisher | OECD [u.a.] |
| record_format | marc |
| series2 | Energy market reform |
| spelling | Ocaña, Carlos Verfasser aut Security of supply in electricity markets evidence and policy issues [the authors of this book are Carlos Ocaña and Aurélie Hariton] Paris OECD [u.a.] 2002 172 S. graph. Darst., Kt. : 23 cm txt rdacontent n rdamedia nc rdacarrier Energy market reform Includes bibliographical references (p. 167-172) OECD (DE-588)5157-3 gnd rswk-swf Elektriciteitsopwekking gtt Elektriciteitsverbruik gtt Elektriciteitsvoorziening gtt Leveranties gtt Liberalisatie gtt Zekerheid gtt Electric power distribution Electric power Economic aspects Electric utilities Management Energy policy Energiepolitik (DE-588)4014715-0 gnd rswk-swf Elektrizitätsmarkt (DE-588)4328181-3 gnd rswk-swf OECD (DE-588)5157-3 b Elektrizitätsmarkt (DE-588)4328181-3 s Energiepolitik (DE-588)4014715-0 s DE-604 Hariton, Aurélie Verfasser aut HBZ Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=010239359&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Ocaña, Carlos Hariton, Aurélie Security of supply in electricity markets evidence and policy issues OECD (DE-588)5157-3 gnd Elektriciteitsopwekking gtt Elektriciteitsverbruik gtt Elektriciteitsvoorziening gtt Leveranties gtt Liberalisatie gtt Zekerheid gtt Electric power distribution Electric power Economic aspects Electric utilities Management Energy policy Energiepolitik (DE-588)4014715-0 gnd Elektrizitätsmarkt (DE-588)4328181-3 gnd |
| subject_GND | (DE-588)5157-3 (DE-588)4014715-0 (DE-588)4328181-3 |
| title | Security of supply in electricity markets evidence and policy issues |
| title_auth | Security of supply in electricity markets evidence and policy issues |
| title_exact_search | Security of supply in electricity markets evidence and policy issues |
| title_full | Security of supply in electricity markets evidence and policy issues [the authors of this book are Carlos Ocaña and Aurélie Hariton] |
| title_fullStr | Security of supply in electricity markets evidence and policy issues [the authors of this book are Carlos Ocaña and Aurélie Hariton] |
| title_full_unstemmed | Security of supply in electricity markets evidence and policy issues [the authors of this book are Carlos Ocaña and Aurélie Hariton] |
| title_short | Security of supply in electricity markets |
| title_sort | security of supply in electricity markets evidence and policy issues |
| title_sub | evidence and policy issues |
| topic | OECD (DE-588)5157-3 gnd Elektriciteitsopwekking gtt Elektriciteitsverbruik gtt Elektriciteitsvoorziening gtt Leveranties gtt Liberalisatie gtt Zekerheid gtt Electric power distribution Electric power Economic aspects Electric utilities Management Energy policy Energiepolitik (DE-588)4014715-0 gnd Elektrizitätsmarkt (DE-588)4328181-3 gnd |
| topic_facet | OECD Elektriciteitsopwekking Elektriciteitsverbruik Elektriciteitsvoorziening Leveranties Liberalisatie Zekerheid Electric power distribution Electric power Economic aspects Electric utilities Management Energy policy Energiepolitik Elektrizitätsmarkt |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=010239359&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT ocanacarlos securityofsupplyinelectricitymarketsevidenceandpolicyissues AT haritonaurelie securityofsupplyinelectricitymarketsevidenceandpolicyissues |