Heinrich von Kleist und Stanisław Wyspiański: ein Vergleich der Tragik in ihren Dramen
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | German |
| Veröffentlicht: |
Kraków
Druk. narodowa
1938
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | 290 S. |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV015713325 | ||
| 003 | DE-604 | ||
| 005 | 20040226 | ||
| 007 | t | ||
| 008 | 021011s1938 |||| 00||| ger d | ||
| 035 | |a (OCoLC)14290642 | ||
| 035 | |a (DE-599)BVBBV015713325 | ||
| 040 | |a DE-604 |b ger | ||
| 041 | 0 | |a ger | |
| 049 | |a DE-12 |a DE-19 |a DE-188 | ||
| 050 | 0 | |a PT2379.Z5 | |
| 084 | |a 7,41 |2 ssgn | ||
| 100 | 1 | |a Rosenthal, Bronisława |e Verfasser |4 aut | |
| 245 | 1 | 0 | |a Heinrich von Kleist und Stanisław Wyspiański |b ein Vergleich der Tragik in ihren Dramen |c Bronisława Rosenthal |
| 264 | 1 | |a Kraków |b Druk. narodowa |c 1938 | |
| 300 | |a 290 S. | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 600 | 1 | 4 | |a Kleist, Heinrich von <1777-1811> |
| 600 | 1 | 4 | |a Wyspiański, Stanisław <1869-1907> |
| 650 | 4 | |a Literature, Comparative |x German and Polish | |
| 650 | 4 | |a Literature, Comparative |x Polish and German | |
| 650 | 4 | |a Tragic, The | |
| 856 | 4 | 2 | |m HEBIS Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=010120573&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 940 | 1 | |n oe | |
| 940 | 1 | |q BSBQK0125 | |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-010120573 | ||
| 942 | 1 | 1 | |e 22/bsb |g 438 |
| 980 | 4 | |a (DE-12)AK48106129 | |
Datensatz im Suchindex
| _version_ | 1804129715944947712 |
|---|---|
| adam_text | DR BRONISLAWA ROSENTHAL
HEINRICH VONK LEIST
UND
STANISLAW WYSPIANSKI
EIN VERGLEICH DER TRAGIK
IN IHREN DRAMEN
Es kann kein böser Geist sein, der
an der Spitze der Welt steht; es
ist ein bloss unbegriffener!
HvKleist,AuseinemBriefe
Piekla i niebios jeden Bog
St Wyspiariski, „Skalka, Akt III
Inv •r s
DRUKARNIANARODOWA
KRAK Ö W1938
INHALT
Seite
Einleitung 7
I Irren 17
II Ringen 33
III Verneinung 57
IV Bejahung 73
V Todesproblem 97
VI Nationalgefühl 133
VII Form 170
Schluss 233
Anmerkungen 239
Literatur 275
|
| any_adam_object | 1 |
| author | Rosenthal, Bronisława |
| author_facet | Rosenthal, Bronisława |
| author_role | aut |
| author_sort | Rosenthal, Bronisława |
| author_variant | b r br |
| building | Verbundindex |
| bvnumber | BV015713325 |
| callnumber-first | P - Language and Literature |
| callnumber-label | PT2379 |
| callnumber-raw | PT2379.Z5 |
| callnumber-search | PT2379.Z5 |
| callnumber-sort | PT 42379 Z5 |
| callnumber-subject | PT - European, Asian and African Literature |
| ctrlnum | (OCoLC)14290642 (DE-599)BVBBV015713325 |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01371nam a2200385 c 4500</leader><controlfield tag="001">BV015713325</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20040226 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">021011s1938 |||| 00||| ger d</controlfield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)14290642</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV015713325</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">ger</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield><subfield code="a">DE-19</subfield><subfield code="a">DE-188</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">PT2379.Z5</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">7,41</subfield><subfield code="2">ssgn</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Rosenthal, Bronisława</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Heinrich von Kleist und Stanisław Wyspiański</subfield><subfield code="b">ein Vergleich der Tragik in ihren Dramen</subfield><subfield code="c">Bronisława Rosenthal</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Kraków</subfield><subfield code="b">Druk. narodowa</subfield><subfield code="c">1938</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">290 S.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="600" ind1="1" ind2="4"><subfield code="a">Kleist, Heinrich von <1777-1811></subfield></datafield><datafield tag="600" ind1="1" ind2="4"><subfield code="a">Wyspiański, Stanisław <1869-1907></subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Literature, Comparative</subfield><subfield code="x">German and Polish</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Literature, Comparative</subfield><subfield code="x">Polish and German</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Tragic, The</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HEBIS Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=010120573&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">oe</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">BSBQK0125</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-010120573</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="e">22/bsb</subfield><subfield code="g">438</subfield></datafield><datafield tag="980" ind1="4" ind2=" "><subfield code="a">(DE-12)AK48106129</subfield></datafield></record></collection> |
| id | DE-604.BV015713325 |
| illustrated | Not Illustrated |
| indexdate | 2024-07-09T19:09:33Z |
| institution | BVB |
| language | German |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-010120573 |
| oclc_num | 14290642 |
| open_access_boolean | |
| owner | DE-12 DE-19 DE-BY-UBM DE-188 |
| owner_facet | DE-12 DE-19 DE-BY-UBM DE-188 |
| physical | 290 S. |
| psigel | BSBQK0125 |
| publishDate | 1938 |
| publishDateSearch | 1938 |
| publishDateSort | 1938 |
| publisher | Druk. narodowa |
| record_format | marc |
| spelling | Rosenthal, Bronisława Verfasser aut Heinrich von Kleist und Stanisław Wyspiański ein Vergleich der Tragik in ihren Dramen Bronisława Rosenthal Kraków Druk. narodowa 1938 290 S. txt rdacontent n rdamedia nc rdacarrier Kleist, Heinrich von <1777-1811> Wyspiański, Stanisław <1869-1907> Literature, Comparative German and Polish Literature, Comparative Polish and German Tragic, The HEBIS Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=010120573&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Rosenthal, Bronisława Heinrich von Kleist und Stanisław Wyspiański ein Vergleich der Tragik in ihren Dramen Kleist, Heinrich von <1777-1811> Wyspiański, Stanisław <1869-1907> Literature, Comparative German and Polish Literature, Comparative Polish and German Tragic, The |
| title | Heinrich von Kleist und Stanisław Wyspiański ein Vergleich der Tragik in ihren Dramen |
| title_auth | Heinrich von Kleist und Stanisław Wyspiański ein Vergleich der Tragik in ihren Dramen |
| title_exact_search | Heinrich von Kleist und Stanisław Wyspiański ein Vergleich der Tragik in ihren Dramen |
| title_full | Heinrich von Kleist und Stanisław Wyspiański ein Vergleich der Tragik in ihren Dramen Bronisława Rosenthal |
| title_fullStr | Heinrich von Kleist und Stanisław Wyspiański ein Vergleich der Tragik in ihren Dramen Bronisława Rosenthal |
| title_full_unstemmed | Heinrich von Kleist und Stanisław Wyspiański ein Vergleich der Tragik in ihren Dramen Bronisława Rosenthal |
| title_short | Heinrich von Kleist und Stanisław Wyspiański |
| title_sort | heinrich von kleist und stanislaw wyspianski ein vergleich der tragik in ihren dramen |
| title_sub | ein Vergleich der Tragik in ihren Dramen |
| topic | Kleist, Heinrich von <1777-1811> Wyspiański, Stanisław <1869-1907> Literature, Comparative German and Polish Literature, Comparative Polish and German Tragic, The |
| topic_facet | Kleist, Heinrich von <1777-1811> Wyspiański, Stanisław <1869-1907> Literature, Comparative German and Polish Literature, Comparative Polish and German Tragic, The |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=010120573&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT rosenthalbronisława heinrichvonkleistundstanisławwyspianskieinvergleichdertragikinihrendramen |