Ideology and settlement: the Jewish National Fund, 1897 - 1914
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
Jerusalem
Magnes Press, the Hebrew Univ.
1998
|
| Schriftenreihe: | Israel studies in historical geography
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | Aus dem Hebr. übers. |
| Beschreibung: | 446 S. Ill., Kt. |
| ISBN: | 9652239895 |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV012463140 | ||
| 003 | DE-604 | ||
| 005 | 20130814 | ||
| 007 | t | ||
| 008 | 990318s1998 ab|| |||| 00||| eng d | ||
| 020 | |a 9652239895 |9 965-223-989-5 | ||
| 035 | |a (OCoLC)237326662 | ||
| 035 | |a (DE-599)BVBBV012463140 | ||
| 040 | |a DE-604 |b ger |e rakddb | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-12 |a DE-188 | ||
| 084 | |a NP 6500 |0 (DE-625)128023: |2 rvk | ||
| 100 | 1 | |a Šîlônî, Ṣevî |e Verfasser |4 aut | |
| 240 | 1 | 0 | |a haq- Qeren haq-qayyemet le-Yiśrā'ēl we-ha-hityašševût haṣ-ṣiyyônît |
| 245 | 1 | 0 | |a Ideology and settlement |b the Jewish National Fund, 1897 - 1914 |c Zvi Shilony |
| 264 | 1 | |a Jerusalem |b Magnes Press, the Hebrew Univ. |c 1998 | |
| 300 | |a 446 S. |b Ill., Kt. | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 0 | |a Israel studies in historical geography | |
| 500 | |a Aus dem Hebr. übers. | ||
| 610 | 2 | 7 | |a Keren Kayemeth LeIsrael |0 (DE-588)1013336-7 |2 gnd |9 rswk-swf |
| 648 | 7 | |a Geschichte 1897-1914 |2 gnd |9 rswk-swf | |
| 650 | 0 | 7 | |a Geschichte |0 (DE-588)4020517-4 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Siedlung |0 (DE-588)4054858-2 |2 gnd |9 rswk-swf |
| 651 | 7 | |a Palästina |0 (DE-588)4044381-4 |2 gnd |9 rswk-swf | |
| 689 | 0 | 0 | |a Palästina |0 (DE-588)4044381-4 |D g |
| 689 | 0 | 1 | |a Siedlung |0 (DE-588)4054858-2 |D s |
| 689 | 0 | 2 | |a Keren Kayemeth LeIsrael |0 (DE-588)1013336-7 |D b |
| 689 | 0 | 3 | |a Geschichte |0 (DE-588)4020517-4 |D s |
| 689 | 0 | |5 DE-604 | |
| 689 | 1 | 0 | |a Keren Kayemeth LeIsrael |0 (DE-588)1013336-7 |D b |
| 689 | 1 | 1 | |a Geschichte 1897-1914 |A z |
| 689 | 1 | |5 DE-604 | |
| 856 | 4 | 2 | |m HEBIS Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=008457499&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-008457499 | ||
Datensatz im Suchindex
| _version_ | 1804127102402822144 |
|---|---|
| adam_text | ZVI SHELONY
IDEOLOGY AND SETTLEMENT
THE JEWISH NATIONAL FUND, 1897-1914
THE MAGNES PRESS, THE HEBREW UNIVERSITY, JERUSALEM
CONTENTS
Preface 11
Introduction 15
Abbreviations 19
Part One: Sources, Founders, and Organization
Chapter One: The European Background 23
1 The Agrarian Reform Movement 23
2 Nationalization of the Land 25
3 The Principle of Self-Labor 26
4 The Cooperative Movement 27
5 Large Organized Settlement Projects 30
Chapter Two: Visionaries and Founders 37
1 Hermann Schapira 38
2 Max Bodenheimer 40
3 Johann Kremenetzky 42
4 Otto Warburg 44
5 Theodor Herzl 47
6 Herzl and Oppenheimer: The Ideal of Cooperation 49
7 Small Plots, Self-Labor, Intensive Farming, and
Primary Equality SI
8 German Colonization in Posen as a Model S3
Chapter Three: Getting into Gear 55
1 First Steps, 1897-1903 55
2 JNF Representation in Palestine, 1903-1907 62
3 JNF Land and Settlement Policy in Summer 1907 84
Part Two: Work in Palestine 1903-1914
Chapter Four: Preparatory Settlement 91
1 Survey Expeditions 91
2 Mapping the Lands of Palestine 97
3 The Agricultural Experimental Station 102
4 Forestation 115
5 Cooperative Settlement a la Oppenheimer 136
6 Other Experimental Settlements 145
Chapter Five: The JNF Acquires Agricultural Land 157
1 Lands South of Lake Kinneret 158
2 The Land of Hittin 169
3 The Land at Bet Arif 174
4 The Land of Huldah 185
5 Tracts Acquired by the JNF East of Haderah 187
6 TheLandofDilb 190
7 The Land at Fule {Merhavyah) 193
8 Further Attempts in the Jezreel Valley 203
Chapter Six: Settling the JNF Agricultural Tracts 209
1 Early Plans for the Tracts South of Lake Kinneret 209
2 Settling the Land of Dalayika 214
3 Settlement at Umm Juni 233
4 Settling the Land of Fule (Merhavyah) 245
5 Bet Arif (Ben Shemen) 258
6 Huldah 274
7 Gan Shemu el 282
Chapter Seven: JNF Work in the Veteran Jewish Colonies 285
1 Agrarian Credit to Settlers in Veteran Colonies 286
2 Assistance to Pioneer Laborers 292
3 Bringing and Settling Yemenite Jews 302
4 The JNF Rescues Faltering Colonies 309
Chapter Eight: The JNF Enhances Jewish Cities 313
1 First Suggestions for Zionist Work in the Cities 313
2 Loans for Setting Up Modern Jewish Suburbs 315
3 Support to High Schools 331
Chapter Nine: Jewish National Institutions 347
1 The Bezalel School of Art 347
2 An Attempt to Establish a National Museum 358
3 The Jewish National Library 360
4 A Tract for the Haifa Technion 368
5 Land for a National Hebrew University 376
Epilogue 386
1 Principal Stages of JNF Activity, 1903-1914 387
2 The JNF s Relations with the Zionist Organization 391
3 The JNF s Autonomous Status 393
4 The JNF Concept of Settlement 393
5 The JNF, Landscape, and the Zionist Settlement Enterprise 395
6 Laying the Foundations 400
List of Illustrations 402
List of World Zionist Organizations Congresses
and Annual Conferences 405
Rough Rates of Exchange between the Major Currencies 405
Length and Area Units Used 405
Bibliography 406
Index 421
|
| any_adam_object | 1 |
| author | Šîlônî, Ṣevî |
| author_facet | Šîlônî, Ṣevî |
| author_role | aut |
| author_sort | Šîlônî, Ṣevî |
| author_variant | ṣ š ṣš |
| building | Verbundindex |
| bvnumber | BV012463140 |
| classification_rvk | NP 6500 |
| ctrlnum | (OCoLC)237326662 (DE-599)BVBBV012463140 |
| discipline | Geschichte |
| era | Geschichte 1897-1914 gnd |
| era_facet | Geschichte 1897-1914 |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01898nam a2200469 c 4500</leader><controlfield tag="001">BV012463140</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20130814 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">990318s1998 ab|| |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9652239895</subfield><subfield code="9">965-223-989-5</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)237326662</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV012463140</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakddb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield><subfield code="a">DE-188</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">NP 6500</subfield><subfield code="0">(DE-625)128023:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Šîlônî, Ṣevî</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="240" ind1="1" ind2="0"><subfield code="a">haq- Qeren haq-qayyemet le-Yiśrā'ēl we-ha-hityašševût haṣ-ṣiyyônît</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Ideology and settlement</subfield><subfield code="b">the Jewish National Fund, 1897 - 1914</subfield><subfield code="c">Zvi Shilony</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Jerusalem</subfield><subfield code="b">Magnes Press, the Hebrew Univ.</subfield><subfield code="c">1998</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">446 S.</subfield><subfield code="b">Ill., Kt.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="0" ind2=" "><subfield code="a">Israel studies in historical geography</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Aus dem Hebr. übers.</subfield></datafield><datafield tag="610" ind1="2" ind2="7"><subfield code="a">Keren Kayemeth LeIsrael</subfield><subfield code="0">(DE-588)1013336-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte 1897-1914</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Geschichte</subfield><subfield code="0">(DE-588)4020517-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Siedlung</subfield><subfield code="0">(DE-588)4054858-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Palästina</subfield><subfield code="0">(DE-588)4044381-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Palästina</subfield><subfield code="0">(DE-588)4044381-4</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Siedlung</subfield><subfield code="0">(DE-588)4054858-2</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Keren Kayemeth LeIsrael</subfield><subfield code="0">(DE-588)1013336-7</subfield><subfield code="D">b</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Geschichte</subfield><subfield code="0">(DE-588)4020517-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="1" ind2="0"><subfield code="a">Keren Kayemeth LeIsrael</subfield><subfield code="0">(DE-588)1013336-7</subfield><subfield code="D">b</subfield></datafield><datafield tag="689" ind1="1" ind2="1"><subfield code="a">Geschichte 1897-1914</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="1" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HEBIS Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=008457499&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-008457499</subfield></datafield></record></collection> |
| geographic | Palästina (DE-588)4044381-4 gnd |
| geographic_facet | Palästina |
| id | DE-604.BV012463140 |
| illustrated | Illustrated |
| indexdate | 2024-07-09T18:28:01Z |
| institution | BVB |
| isbn | 9652239895 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-008457499 |
| oclc_num | 237326662 |
| open_access_boolean | |
| owner | DE-12 DE-188 |
| owner_facet | DE-12 DE-188 |
| physical | 446 S. Ill., Kt. |
| publishDate | 1998 |
| publishDateSearch | 1998 |
| publishDateSort | 1998 |
| publisher | Magnes Press, the Hebrew Univ. |
| record_format | marc |
| series2 | Israel studies in historical geography |
| spelling | Šîlônî, Ṣevî Verfasser aut haq- Qeren haq-qayyemet le-Yiśrā'ēl we-ha-hityašševût haṣ-ṣiyyônît Ideology and settlement the Jewish National Fund, 1897 - 1914 Zvi Shilony Jerusalem Magnes Press, the Hebrew Univ. 1998 446 S. Ill., Kt. txt rdacontent n rdamedia nc rdacarrier Israel studies in historical geography Aus dem Hebr. übers. Keren Kayemeth LeIsrael (DE-588)1013336-7 gnd rswk-swf Geschichte 1897-1914 gnd rswk-swf Geschichte (DE-588)4020517-4 gnd rswk-swf Siedlung (DE-588)4054858-2 gnd rswk-swf Palästina (DE-588)4044381-4 gnd rswk-swf Palästina (DE-588)4044381-4 g Siedlung (DE-588)4054858-2 s Keren Kayemeth LeIsrael (DE-588)1013336-7 b Geschichte (DE-588)4020517-4 s DE-604 Geschichte 1897-1914 z HEBIS Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=008457499&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Šîlônî, Ṣevî Ideology and settlement the Jewish National Fund, 1897 - 1914 Keren Kayemeth LeIsrael (DE-588)1013336-7 gnd Geschichte (DE-588)4020517-4 gnd Siedlung (DE-588)4054858-2 gnd |
| subject_GND | (DE-588)1013336-7 (DE-588)4020517-4 (DE-588)4054858-2 (DE-588)4044381-4 |
| title | Ideology and settlement the Jewish National Fund, 1897 - 1914 |
| title_alt | haq- Qeren haq-qayyemet le-Yiśrā'ēl we-ha-hityašševût haṣ-ṣiyyônît |
| title_auth | Ideology and settlement the Jewish National Fund, 1897 - 1914 |
| title_exact_search | Ideology and settlement the Jewish National Fund, 1897 - 1914 |
| title_full | Ideology and settlement the Jewish National Fund, 1897 - 1914 Zvi Shilony |
| title_fullStr | Ideology and settlement the Jewish National Fund, 1897 - 1914 Zvi Shilony |
| title_full_unstemmed | Ideology and settlement the Jewish National Fund, 1897 - 1914 Zvi Shilony |
| title_short | Ideology and settlement |
| title_sort | ideology and settlement the jewish national fund 1897 1914 |
| title_sub | the Jewish National Fund, 1897 - 1914 |
| topic | Keren Kayemeth LeIsrael (DE-588)1013336-7 gnd Geschichte (DE-588)4020517-4 gnd Siedlung (DE-588)4054858-2 gnd |
| topic_facet | Keren Kayemeth LeIsrael Geschichte Siedlung Palästina |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=008457499&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT silonisevi haqqerenhaqqayyemetleyisraelwehahityassevuthassiyyonit AT silonisevi ideologyandsettlementthejewishnationalfund18971914 |