Führung unter Belastung: ausgewählte Aspekte der Militärpsychologie
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | German |
| Veröffentlicht: |
Frauenfeld ; Stuttgart ; Wien
Huber
1998
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | Literaturverz. S. 187 - 200 |
| Beschreibung: | 200 S. graph. Darst. |
| ISBN: | 3719311651 |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV012157714 | ||
| 003 | DE-604 | ||
| 005 | 19990128 | ||
| 007 | t | ||
| 008 | 980908s1998 gw d||| |||| 00||| ger d | ||
| 016 | 7 | |a 954012941 |2 DE-101 | |
| 020 | |a 3719311651 |9 3-7193-1165-1 | ||
| 035 | |a (OCoLC)44173242 | ||
| 035 | |a (DE-599)BVBBV012157714 | ||
| 040 | |a DE-604 |b ger |e rakddb | ||
| 041 | 0 | |a ger | |
| 044 | |a gw |c DE | ||
| 049 | |a DE-703 |a DE-12 |a DE-739 |a DE-706 | ||
| 050 | 0 | |a UB210 | |
| 082 | 0 | |a 355.3/3041 |2 21 | |
| 084 | |a CW 9000 |0 (DE-625)19210: |2 rvk | ||
| 084 | |a MY 5250 |0 (DE-625)123906: |2 rvk | ||
| 100 | 1 | |a Stadelmann, Jürg |e Verfasser |4 aut | |
| 245 | 1 | 0 | |a Führung unter Belastung |b ausgewählte Aspekte der Militärpsychologie |c Jürg Stadelmann |
| 264 | 1 | |a Frauenfeld ; Stuttgart ; Wien |b Huber |c 1998 | |
| 300 | |a 200 S. |b graph. Darst. | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 500 | |a Literaturverz. S. 187 - 200 | ||
| 650 | 4 | |a Führung | |
| 650 | 4 | |a Command of troops | |
| 650 | 4 | |a Leadership | |
| 650 | 4 | |a Psychology, Military | |
| 650 | 0 | 7 | |a Militärpsychologie |0 (DE-588)4074821-2 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Militär |0 (DE-588)4039305-7 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Stressbewältigung |0 (DE-588)4202646-5 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Führung |0 (DE-588)4018776-7 |2 gnd |9 rswk-swf |
| 689 | 0 | 0 | |a Militärpsychologie |0 (DE-588)4074821-2 |D s |
| 689 | 0 | |5 DE-604 | |
| 689 | 1 | 0 | |a Militär |0 (DE-588)4039305-7 |D s |
| 689 | 1 | 1 | |a Führung |0 (DE-588)4018776-7 |D s |
| 689 | 1 | 2 | |a Stressbewältigung |0 (DE-588)4202646-5 |D s |
| 689 | 1 | |5 DE-604 | |
| 856 | 4 | 2 | |m DNB Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=008235762&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-008235762 | ||
Datensatz im Suchindex
| _version_ | 1804126768721821696 |
|---|---|
| any_adam_object | 1 |
| author | Stadelmann, Jürg |
| author_facet | Stadelmann, Jürg |
| author_role | aut |
| author_sort | Stadelmann, Jürg |
| author_variant | j s js |
| building | Verbundindex |
| bvnumber | BV012157714 |
| callnumber-first | U - Military Science |
| callnumber-label | UB210 |
| callnumber-raw | UB210 |
| callnumber-search | UB210 |
| callnumber-sort | UB 3210 |
| callnumber-subject | UB - Military Administration |
| classification_rvk | CW 9000 MY 5250 |
| ctrlnum | (OCoLC)44173242 (DE-599)BVBBV012157714 |
| dewey-full | 355.3/3041 |
| dewey-hundreds | 300 - Social sciences |
| dewey-ones | 355 - Military science |
| dewey-raw | 355.3/3041 |
| dewey-search | 355.3/3041 |
| dewey-sort | 3355.3 43041 |
| dewey-tens | 350 - Public administration and military science |
| discipline | Psychologie Militärwissenschaft |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01901nam a2200517 c 4500</leader><controlfield tag="001">BV012157714</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">19990128 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">980908s1998 gw d||| |||| 00||| ger d</controlfield><datafield tag="016" ind1="7" ind2=" "><subfield code="a">954012941</subfield><subfield code="2">DE-101</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3719311651</subfield><subfield code="9">3-7193-1165-1</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)44173242</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV012157714</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakddb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">ger</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">gw</subfield><subfield code="c">DE</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-703</subfield><subfield code="a">DE-12</subfield><subfield code="a">DE-739</subfield><subfield code="a">DE-706</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">UB210</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">355.3/3041</subfield><subfield code="2">21</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">CW 9000</subfield><subfield code="0">(DE-625)19210:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">MY 5250</subfield><subfield code="0">(DE-625)123906:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Stadelmann, Jürg</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Führung unter Belastung</subfield><subfield code="b">ausgewählte Aspekte der Militärpsychologie</subfield><subfield code="c">Jürg Stadelmann</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Frauenfeld ; Stuttgart ; Wien</subfield><subfield code="b">Huber</subfield><subfield code="c">1998</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">200 S.</subfield><subfield code="b">graph. Darst.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Literaturverz. S. 187 - 200</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Führung</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Command of troops</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Leadership</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Psychology, Military</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Militärpsychologie</subfield><subfield code="0">(DE-588)4074821-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Militär</subfield><subfield code="0">(DE-588)4039305-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Stressbewältigung</subfield><subfield code="0">(DE-588)4202646-5</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Führung</subfield><subfield code="0">(DE-588)4018776-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Militärpsychologie</subfield><subfield code="0">(DE-588)4074821-2</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="1" ind2="0"><subfield code="a">Militär</subfield><subfield code="0">(DE-588)4039305-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="1"><subfield code="a">Führung</subfield><subfield code="0">(DE-588)4018776-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="2"><subfield code="a">Stressbewältigung</subfield><subfield code="0">(DE-588)4202646-5</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">DNB Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=008235762&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-008235762</subfield></datafield></record></collection> |
| id | DE-604.BV012157714 |
| illustrated | Illustrated |
| indexdate | 2024-07-09T18:22:42Z |
| institution | BVB |
| isbn | 3719311651 |
| language | German |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-008235762 |
| oclc_num | 44173242 |
| open_access_boolean | |
| owner | DE-703 DE-12 DE-739 DE-706 |
| owner_facet | DE-703 DE-12 DE-739 DE-706 |
| physical | 200 S. graph. Darst. |
| publishDate | 1998 |
| publishDateSearch | 1998 |
| publishDateSort | 1998 |
| publisher | Huber |
| record_format | marc |
| spelling | Stadelmann, Jürg Verfasser aut Führung unter Belastung ausgewählte Aspekte der Militärpsychologie Jürg Stadelmann Frauenfeld ; Stuttgart ; Wien Huber 1998 200 S. graph. Darst. txt rdacontent n rdamedia nc rdacarrier Literaturverz. S. 187 - 200 Führung Command of troops Leadership Psychology, Military Militärpsychologie (DE-588)4074821-2 gnd rswk-swf Militär (DE-588)4039305-7 gnd rswk-swf Stressbewältigung (DE-588)4202646-5 gnd rswk-swf Führung (DE-588)4018776-7 gnd rswk-swf Militärpsychologie (DE-588)4074821-2 s DE-604 Militär (DE-588)4039305-7 s Führung (DE-588)4018776-7 s Stressbewältigung (DE-588)4202646-5 s DNB Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=008235762&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Stadelmann, Jürg Führung unter Belastung ausgewählte Aspekte der Militärpsychologie Führung Command of troops Leadership Psychology, Military Militärpsychologie (DE-588)4074821-2 gnd Militär (DE-588)4039305-7 gnd Stressbewältigung (DE-588)4202646-5 gnd Führung (DE-588)4018776-7 gnd |
| subject_GND | (DE-588)4074821-2 (DE-588)4039305-7 (DE-588)4202646-5 (DE-588)4018776-7 |
| title | Führung unter Belastung ausgewählte Aspekte der Militärpsychologie |
| title_auth | Führung unter Belastung ausgewählte Aspekte der Militärpsychologie |
| title_exact_search | Führung unter Belastung ausgewählte Aspekte der Militärpsychologie |
| title_full | Führung unter Belastung ausgewählte Aspekte der Militärpsychologie Jürg Stadelmann |
| title_fullStr | Führung unter Belastung ausgewählte Aspekte der Militärpsychologie Jürg Stadelmann |
| title_full_unstemmed | Führung unter Belastung ausgewählte Aspekte der Militärpsychologie Jürg Stadelmann |
| title_short | Führung unter Belastung |
| title_sort | fuhrung unter belastung ausgewahlte aspekte der militarpsychologie |
| title_sub | ausgewählte Aspekte der Militärpsychologie |
| topic | Führung Command of troops Leadership Psychology, Military Militärpsychologie (DE-588)4074821-2 gnd Militär (DE-588)4039305-7 gnd Stressbewältigung (DE-588)4202646-5 gnd Führung (DE-588)4018776-7 gnd |
| topic_facet | Führung Command of troops Leadership Psychology, Military Militärpsychologie Militär Stressbewältigung |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=008235762&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT stadelmannjurg fuhrungunterbelastungausgewahlteaspektedermilitarpsychologie |