Marriage, family, and law in medieval Europe: collected studies
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
Toronto [u.a.]
Univ. of Toronto Press
1996
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | XXX, 330 S. |
| ISBN: | 0802007090 |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV010923607 | ||
| 003 | DE-604 | ||
| 005 | 20190627 | ||
| 007 | t | ||
| 008 | 960902s1996 xxc |||| 00||| eng d | ||
| 020 | |a 0802007090 |9 0-8020-0709-0 | ||
| 035 | |a (OCoLC)247305751 | ||
| 035 | |a (DE-599)BVBBV010923607 | ||
| 040 | |a DE-604 |b ger |e rakddb | ||
| 041 | 0 | |a eng | |
| 044 | |a xxc |c XD-CA | ||
| 049 | |a DE-739 |a DE-12 |a DE-473 |a DE-355 |a DE-384 |a DE-29 |a DE-521 |a DE-B220 | ||
| 050 | 0 | |a HQ611.S48 1996 | |
| 082 | 0 | |a 306.8/094 21 | |
| 084 | |a NK 8200 |0 (DE-625)126249: |2 rvk | ||
| 084 | |a NW 8150 |0 (DE-625)132307: |2 rvk | ||
| 084 | |a PW 9000 |0 (DE-625)140983: |2 rvk | ||
| 100 | 1 | |a Sheehan, Michael M. |d 1925-1992 |e Verfasser |0 (DE-588)121019101 |4 aut | |
| 245 | 1 | 0 | |a Marriage, family, and law in medieval Europe |b collected studies |c Michael M. Sheehan. Ed. by James K. Farge |
| 264 | 1 | |a Toronto [u.a.] |b Univ. of Toronto Press |c 1996 | |
| 300 | |a XXX, 330 S. | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 600 | 1 | 7 | |a Sheehan, Michael M. |d 1925-1992 |0 (DE-588)121019101 |2 gnd |9 rswk-swf |
| 648 | 7 | |a Geschichte 500-1500 |2 gnd |9 rswk-swf | |
| 650 | 4 | |a Geschichte | |
| 650 | 4 | |a Sozialgeschichte | |
| 650 | 4 | |a Marriage -- Europe -- History | |
| 650 | 4 | |a Marriage (Canon law) | |
| 650 | 4 | |a Family -- Europe -- History | |
| 650 | 4 | |a Wills -- Europe -- History | |
| 650 | 4 | |a Wills (Canon law) | |
| 650 | 4 | |a Social history -- Medieval, 500-1500 | |
| 650 | 4 | |a Law, Medieval | |
| 650 | 0 | 7 | |a Eherecht |0 (DE-588)4013652-8 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Familienrecht |0 (DE-588)4016419-6 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Bibliografie |0 (DE-588)4006432-3 |2 gnd |9 rswk-swf |
| 651 | 4 | |a Europa | |
| 651 | 4 | |a Europe -- Social conditions -- to 1492 | |
| 655 | 7 | |0 (DE-588)4143413-4 |a Aufsatzsammlung |2 gnd-content | |
| 689 | 0 | 0 | |a Eherecht |0 (DE-588)4013652-8 |D s |
| 689 | 0 | 1 | |a Geschichte 500-1500 |A z |
| 689 | 0 | |5 DE-604 | |
| 689 | 1 | 0 | |a Familienrecht |0 (DE-588)4016419-6 |D s |
| 689 | 1 | 1 | |a Geschichte 500-1500 |A z |
| 689 | 1 | |5 DE-604 | |
| 689 | 2 | 0 | |a Sheehan, Michael M. |d 1925-1992 |0 (DE-588)121019101 |D p |
| 689 | 2 | 1 | |a Bibliografie |0 (DE-588)4006432-3 |D s |
| 689 | 2 | |5 DE-604 | |
| 700 | 1 | |a Farge, James K. |d 1938- |e Sonstige |0 (DE-588)172071577 |4 oth | |
| 856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=007306897&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-007306897 | ||
Datensatz im Suchindex
| _version_ | 1804125414263619584 |
|---|---|
| adam_text | Contents
Foreword by James K. Farge vii
Introduction by Joel T. Rosenthal xiii
Acknowledgments xxix
Abbreviations xxxi
ONE
Report of a Thesis on the Will in Medieval England 3
TWO
A List of Thirteenth Century English Wills 8
THREE
The Influence of Canon Law
on the Property Rights of Married Women in England 16
FOUR
Canon Law and English Institutions:
Some Notes on Current Research 31
FIVE
The Formation and Stability of Marriage
in Fourteenth Century England: Evidence of an Ely Register 38
SIX
Marriage and Family
in English Conciliar and Synodal Legislation 77
vi Contents
SEVEN
Choice of Marriage Partner in the Middle Ages:
Development and Mode of Application of a Theory of Marriage 87
EIGHT
Marriage Theory and Practice
in the Conciliar Legislation
and Diocesan Statutes of Medieval England 118
NINE
The Wife of Bath and Her Four Sisters:
Reflections on a Woman s Life in the Age of Chaucer 177
TEN
English Wills and the Records
of the Ecclesiastical and Civil Jurisdictions 199
ELEVEN
Theory and Practice: Marriage
of the Unfree and the Poor in Medieval Society 211
TWELVE
The European Family and Canon Law 247
THIRTEEN
Maritalis affectio Revisited 262
FOURTEEN
The Bishop of Rome to a Barbarian King
on the Rituals of Marriage 278
FIFTEEN
Sexuality, Marriage, Celibacy, and the Family
in Central and Northern Italy:
Christian Legal and Moral Guides in the Early Middle Ages 292
SIXTEEN
The Bequest of Land in England
in the High Middle Ages: Testaments and the Law 311
Bibliography of Michael M. Sheehan, CSB 324
Compiled by Mary C. English and James K. Farge
|
| any_adam_object | 1 |
| author | Sheehan, Michael M. 1925-1992 |
| author_GND | (DE-588)121019101 (DE-588)172071577 |
| author_facet | Sheehan, Michael M. 1925-1992 |
| author_role | aut |
| author_sort | Sheehan, Michael M. 1925-1992 |
| author_variant | m m s mm mms |
| building | Verbundindex |
| bvnumber | BV010923607 |
| callnumber-first | H - Social Science |
| callnumber-label | HQ611 |
| callnumber-raw | HQ611.S48 1996 |
| callnumber-search | HQ611.S48 1996 |
| callnumber-sort | HQ 3611 S48 41996 |
| callnumber-subject | HQ - Family, Marriage, Women |
| classification_rvk | NK 8200 NW 8150 PW 9000 |
| ctrlnum | (OCoLC)247305751 (DE-599)BVBBV010923607 |
| dewey-full | 306.8/09421 |
| dewey-hundreds | 300 - Social sciences |
| dewey-ones | 306 - Culture and institutions |
| dewey-raw | 306.8/094 21 |
| dewey-search | 306.8/094 21 |
| dewey-sort | 3306.8 294 221 |
| dewey-tens | 300 - Social sciences |
| discipline | Rechtswissenschaft Soziologie Geschichte |
| era | Geschichte 500-1500 gnd |
| era_facet | Geschichte 500-1500 |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>02567nam a2200661 c 4500</leader><controlfield tag="001">BV010923607</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20190627 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">960902s1996 xxc |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">0802007090</subfield><subfield code="9">0-8020-0709-0</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)247305751</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV010923607</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakddb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">xxc</subfield><subfield code="c">XD-CA</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-739</subfield><subfield code="a">DE-12</subfield><subfield code="a">DE-473</subfield><subfield code="a">DE-355</subfield><subfield code="a">DE-384</subfield><subfield code="a">DE-29</subfield><subfield code="a">DE-521</subfield><subfield code="a">DE-B220</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">HQ611.S48 1996</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">306.8/094 21</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">NK 8200</subfield><subfield code="0">(DE-625)126249:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">NW 8150</subfield><subfield code="0">(DE-625)132307:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">PW 9000</subfield><subfield code="0">(DE-625)140983:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Sheehan, Michael M.</subfield><subfield code="d">1925-1992</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)121019101</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Marriage, family, and law in medieval Europe</subfield><subfield code="b">collected studies</subfield><subfield code="c">Michael M. Sheehan. Ed. by James K. Farge</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Toronto [u.a.]</subfield><subfield code="b">Univ. of Toronto Press</subfield><subfield code="c">1996</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">XXX, 330 S.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="600" ind1="1" ind2="7"><subfield code="a">Sheehan, Michael M.</subfield><subfield code="d">1925-1992</subfield><subfield code="0">(DE-588)121019101</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte 500-1500</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Geschichte</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Sozialgeschichte</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Marriage -- Europe -- History</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Marriage (Canon law)</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Family -- Europe -- History</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Wills -- Europe -- History</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Wills (Canon law)</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Social history -- Medieval, 500-1500</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Law, Medieval</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Eherecht</subfield><subfield code="0">(DE-588)4013652-8</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Familienrecht</subfield><subfield code="0">(DE-588)4016419-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Bibliografie</subfield><subfield code="0">(DE-588)4006432-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="4"><subfield code="a">Europa</subfield></datafield><datafield tag="651" ind1=" " ind2="4"><subfield code="a">Europe -- Social conditions -- to 1492</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)4143413-4</subfield><subfield code="a">Aufsatzsammlung</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Eherecht</subfield><subfield code="0">(DE-588)4013652-8</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Geschichte 500-1500</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="1" ind2="0"><subfield code="a">Familienrecht</subfield><subfield code="0">(DE-588)4016419-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="1"><subfield code="a">Geschichte 500-1500</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="1" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="2" ind2="0"><subfield code="a">Sheehan, Michael M.</subfield><subfield code="d">1925-1992</subfield><subfield code="0">(DE-588)121019101</subfield><subfield code="D">p</subfield></datafield><datafield tag="689" ind1="2" ind2="1"><subfield code="a">Bibliografie</subfield><subfield code="0">(DE-588)4006432-3</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="2" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Farge, James K.</subfield><subfield code="d">1938-</subfield><subfield code="e">Sonstige</subfield><subfield code="0">(DE-588)172071577</subfield><subfield code="4">oth</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=007306897&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-007306897</subfield></datafield></record></collection> |
| genre | (DE-588)4143413-4 Aufsatzsammlung gnd-content |
| genre_facet | Aufsatzsammlung |
| geographic | Europa Europe -- Social conditions -- to 1492 |
| geographic_facet | Europa Europe -- Social conditions -- to 1492 |
| id | DE-604.BV010923607 |
| illustrated | Not Illustrated |
| indexdate | 2024-07-09T18:01:11Z |
| institution | BVB |
| isbn | 0802007090 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-007306897 |
| oclc_num | 247305751 |
| open_access_boolean | |
| owner | DE-739 DE-12 DE-473 DE-BY-UBG DE-355 DE-BY-UBR DE-384 DE-29 DE-521 DE-B220 |
| owner_facet | DE-739 DE-12 DE-473 DE-BY-UBG DE-355 DE-BY-UBR DE-384 DE-29 DE-521 DE-B220 |
| physical | XXX, 330 S. |
| publishDate | 1996 |
| publishDateSearch | 1996 |
| publishDateSort | 1996 |
| publisher | Univ. of Toronto Press |
| record_format | marc |
| spelling | Sheehan, Michael M. 1925-1992 Verfasser (DE-588)121019101 aut Marriage, family, and law in medieval Europe collected studies Michael M. Sheehan. Ed. by James K. Farge Toronto [u.a.] Univ. of Toronto Press 1996 XXX, 330 S. txt rdacontent n rdamedia nc rdacarrier Sheehan, Michael M. 1925-1992 (DE-588)121019101 gnd rswk-swf Geschichte 500-1500 gnd rswk-swf Geschichte Sozialgeschichte Marriage -- Europe -- History Marriage (Canon law) Family -- Europe -- History Wills -- Europe -- History Wills (Canon law) Social history -- Medieval, 500-1500 Law, Medieval Eherecht (DE-588)4013652-8 gnd rswk-swf Familienrecht (DE-588)4016419-6 gnd rswk-swf Bibliografie (DE-588)4006432-3 gnd rswk-swf Europa Europe -- Social conditions -- to 1492 (DE-588)4143413-4 Aufsatzsammlung gnd-content Eherecht (DE-588)4013652-8 s Geschichte 500-1500 z DE-604 Familienrecht (DE-588)4016419-6 s Sheehan, Michael M. 1925-1992 (DE-588)121019101 p Bibliografie (DE-588)4006432-3 s Farge, James K. 1938- Sonstige (DE-588)172071577 oth HBZ Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=007306897&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Sheehan, Michael M. 1925-1992 Marriage, family, and law in medieval Europe collected studies Sheehan, Michael M. 1925-1992 (DE-588)121019101 gnd Geschichte Sozialgeschichte Marriage -- Europe -- History Marriage (Canon law) Family -- Europe -- History Wills -- Europe -- History Wills (Canon law) Social history -- Medieval, 500-1500 Law, Medieval Eherecht (DE-588)4013652-8 gnd Familienrecht (DE-588)4016419-6 gnd Bibliografie (DE-588)4006432-3 gnd |
| subject_GND | (DE-588)121019101 (DE-588)4013652-8 (DE-588)4016419-6 (DE-588)4006432-3 (DE-588)4143413-4 |
| title | Marriage, family, and law in medieval Europe collected studies |
| title_auth | Marriage, family, and law in medieval Europe collected studies |
| title_exact_search | Marriage, family, and law in medieval Europe collected studies |
| title_full | Marriage, family, and law in medieval Europe collected studies Michael M. Sheehan. Ed. by James K. Farge |
| title_fullStr | Marriage, family, and law in medieval Europe collected studies Michael M. Sheehan. Ed. by James K. Farge |
| title_full_unstemmed | Marriage, family, and law in medieval Europe collected studies Michael M. Sheehan. Ed. by James K. Farge |
| title_short | Marriage, family, and law in medieval Europe |
| title_sort | marriage family and law in medieval europe collected studies |
| title_sub | collected studies |
| topic | Sheehan, Michael M. 1925-1992 (DE-588)121019101 gnd Geschichte Sozialgeschichte Marriage -- Europe -- History Marriage (Canon law) Family -- Europe -- History Wills -- Europe -- History Wills (Canon law) Social history -- Medieval, 500-1500 Law, Medieval Eherecht (DE-588)4013652-8 gnd Familienrecht (DE-588)4016419-6 gnd Bibliografie (DE-588)4006432-3 gnd |
| topic_facet | Sheehan, Michael M. 1925-1992 Geschichte Sozialgeschichte Marriage -- Europe -- History Marriage (Canon law) Family -- Europe -- History Wills -- Europe -- History Wills (Canon law) Social history -- Medieval, 500-1500 Law, Medieval Eherecht Familienrecht Bibliografie Europa Europe -- Social conditions -- to 1492 Aufsatzsammlung |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=007306897&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT sheehanmichaelm marriagefamilyandlawinmedievaleuropecollectedstudies AT fargejamesk marriagefamilyandlawinmedievaleuropecollectedstudies |