Depositional, structural and sequence framework of the gas-bearing Cleveland Formation (Upper Pennsylvanian), western Anadarko Basin, Texas Panhandle:
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
Austin, Tex. u.a.
1994
|
| Schriftenreihe: | Bureau of Economic Geology <Austin, Tex.>: Report of investigations
213 |
| Schlagworte: | |
| Beschreibung: | V, 73 S. zahlr. Ill, graph. Darst., und Kt. |
Internformat
MARC
| LEADER | 00000nam a2200000 cb4500 | ||
|---|---|---|---|
| 001 | BV010064497 | ||
| 003 | DE-604 | ||
| 005 | 19950301 | ||
| 007 | t | ||
| 008 | 950222s1994 abd| |||| 00||| engod | ||
| 035 | |a (OCoLC)30823611 | ||
| 035 | |a (DE-599)BVBBV010064497 | ||
| 040 | |a DE-604 |b ger |e rakddb | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-19 | ||
| 050 | 0 | |a QE167 | |
| 082 | 0 | |a 551.4109764 | |
| 100 | 1 | |a Hentz, Tucker F. |e Verfasser |4 aut | |
| 245 | 1 | 0 | |a Depositional, structural and sequence framework of the gas-bearing Cleveland Formation (Upper Pennsylvanian), western Anadarko Basin, Texas Panhandle |c Tucker F. Hentz |
| 264 | 1 | |a Austin, Tex. u.a. |c 1994 | |
| 300 | |a V, 73 S. |b zahlr. Ill, graph. Darst., und Kt. | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 1 | |a Bureau of Economic Geology <Austin, Tex.>: Report of investigations |v 213 | |
| 650 | 4 | |a Geology, Stratigraphic |y Pennsylvanian | |
| 650 | 4 | |a Geology, Structural |z Texas |z Anadarko Basin | |
| 650 | 4 | |a Sedimentation and deposition |z Texas |z Anadarko Basin | |
| 651 | 4 | |a Cleveland Formation (Tex.) | |
| 830 | 0 | |a Bureau of Economic Geology <Austin, Tex.>: Report of investigations |v 213 |w (DE-604)BV000901482 |9 213 | |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-006678110 | ||
Datensatz im Suchindex
| _version_ | 1804124449813823488 |
|---|---|
| any_adam_object | |
| author | Hentz, Tucker F. |
| author_facet | Hentz, Tucker F. |
| author_role | aut |
| author_sort | Hentz, Tucker F. |
| author_variant | t f h tf tfh |
| building | Verbundindex |
| bvnumber | BV010064497 |
| callnumber-first | Q - Science |
| callnumber-label | QE167 |
| callnumber-raw | QE167 |
| callnumber-search | QE167 |
| callnumber-sort | QE 3167 |
| callnumber-subject | QE - Geology |
| ctrlnum | (OCoLC)30823611 (DE-599)BVBBV010064497 |
| dewey-full | 551.4109764 |
| dewey-hundreds | 500 - Natural sciences and mathematics |
| dewey-ones | 551 - Geology, hydrology, meteorology |
| dewey-raw | 551.4109764 |
| dewey-search | 551.4109764 |
| dewey-sort | 3551.4109764 |
| dewey-tens | 550 - Earth sciences |
| discipline | Geologie / Paläontologie |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01269nam a2200337 cb4500</leader><controlfield tag="001">BV010064497</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">19950301 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">950222s1994 abd| |||| 00||| engod</controlfield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)30823611</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV010064497</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakddb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-19</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">QE167</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">551.4109764</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Hentz, Tucker F.</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Depositional, structural and sequence framework of the gas-bearing Cleveland Formation (Upper Pennsylvanian), western Anadarko Basin, Texas Panhandle</subfield><subfield code="c">Tucker F. Hentz</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Austin, Tex. u.a.</subfield><subfield code="c">1994</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">V, 73 S.</subfield><subfield code="b">zahlr. Ill, graph. Darst., und Kt.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Bureau of Economic Geology <Austin, Tex.>: Report of investigations</subfield><subfield code="v">213</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Geology, Stratigraphic</subfield><subfield code="y">Pennsylvanian</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Geology, Structural</subfield><subfield code="z">Texas</subfield><subfield code="z">Anadarko Basin</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Sedimentation and deposition</subfield><subfield code="z">Texas</subfield><subfield code="z">Anadarko Basin</subfield></datafield><datafield tag="651" ind1=" " ind2="4"><subfield code="a">Cleveland Formation (Tex.)</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Bureau of Economic Geology <Austin, Tex.>: Report of investigations</subfield><subfield code="v">213</subfield><subfield code="w">(DE-604)BV000901482</subfield><subfield code="9">213</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-006678110</subfield></datafield></record></collection> |
| geographic | Cleveland Formation (Tex.) |
| geographic_facet | Cleveland Formation (Tex.) |
| id | DE-604.BV010064497 |
| illustrated | Illustrated |
| indexdate | 2024-07-09T17:45:51Z |
| institution | BVB |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-006678110 |
| oclc_num | 30823611 |
| open_access_boolean | |
| owner | DE-19 DE-BY-UBM |
| owner_facet | DE-19 DE-BY-UBM |
| physical | V, 73 S. zahlr. Ill, graph. Darst., und Kt. |
| publishDate | 1994 |
| publishDateSearch | 1994 |
| publishDateSort | 1994 |
| record_format | marc |
| series | Bureau of Economic Geology <Austin, Tex.>: Report of investigations |
| series2 | Bureau of Economic Geology <Austin, Tex.>: Report of investigations |
| spelling | Hentz, Tucker F. Verfasser aut Depositional, structural and sequence framework of the gas-bearing Cleveland Formation (Upper Pennsylvanian), western Anadarko Basin, Texas Panhandle Tucker F. Hentz Austin, Tex. u.a. 1994 V, 73 S. zahlr. Ill, graph. Darst., und Kt. txt rdacontent n rdamedia nc rdacarrier Bureau of Economic Geology <Austin, Tex.>: Report of investigations 213 Geology, Stratigraphic Pennsylvanian Geology, Structural Texas Anadarko Basin Sedimentation and deposition Texas Anadarko Basin Cleveland Formation (Tex.) Bureau of Economic Geology <Austin, Tex.>: Report of investigations 213 (DE-604)BV000901482 213 |
| spellingShingle | Hentz, Tucker F. Depositional, structural and sequence framework of the gas-bearing Cleveland Formation (Upper Pennsylvanian), western Anadarko Basin, Texas Panhandle Bureau of Economic Geology <Austin, Tex.>: Report of investigations Geology, Stratigraphic Pennsylvanian Geology, Structural Texas Anadarko Basin Sedimentation and deposition Texas Anadarko Basin |
| title | Depositional, structural and sequence framework of the gas-bearing Cleveland Formation (Upper Pennsylvanian), western Anadarko Basin, Texas Panhandle |
| title_auth | Depositional, structural and sequence framework of the gas-bearing Cleveland Formation (Upper Pennsylvanian), western Anadarko Basin, Texas Panhandle |
| title_exact_search | Depositional, structural and sequence framework of the gas-bearing Cleveland Formation (Upper Pennsylvanian), western Anadarko Basin, Texas Panhandle |
| title_full | Depositional, structural and sequence framework of the gas-bearing Cleveland Formation (Upper Pennsylvanian), western Anadarko Basin, Texas Panhandle Tucker F. Hentz |
| title_fullStr | Depositional, structural and sequence framework of the gas-bearing Cleveland Formation (Upper Pennsylvanian), western Anadarko Basin, Texas Panhandle Tucker F. Hentz |
| title_full_unstemmed | Depositional, structural and sequence framework of the gas-bearing Cleveland Formation (Upper Pennsylvanian), western Anadarko Basin, Texas Panhandle Tucker F. Hentz |
| title_short | Depositional, structural and sequence framework of the gas-bearing Cleveland Formation (Upper Pennsylvanian), western Anadarko Basin, Texas Panhandle |
| title_sort | depositional structural and sequence framework of the gas bearing cleveland formation upper pennsylvanian western anadarko basin texas panhandle |
| topic | Geology, Stratigraphic Pennsylvanian Geology, Structural Texas Anadarko Basin Sedimentation and deposition Texas Anadarko Basin |
| topic_facet | Geology, Stratigraphic Pennsylvanian Geology, Structural Texas Anadarko Basin Sedimentation and deposition Texas Anadarko Basin Cleveland Formation (Tex.) |
| volume_link | (DE-604)BV000901482 |
| work_keys_str_mv | AT hentztuckerf depositionalstructuralandsequenceframeworkofthegasbearingclevelandformationupperpennsylvanianwesternanadarkobasintexaspanhandle |