Die Hierarchie im System der Sprache: Werkauswahl mit Einleitung und Bibliographie
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Weitere Verfasser: | |
| Format: | Buch |
| Sprache: | German |
| Veröffentlicht: |
München
Fink
1978
|
| Schriftenreihe: | Internationale Bibliothek für allgemeine Linguistik
35 |
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | 315 S. graph. Darst. |
| ISBN: | 3770511514 |
Internformat
MARC
| LEADER | 00000nam a2200000 cb4500 | ||
|---|---|---|---|
| 001 | BV003274879 | ||
| 003 | DE-604 | ||
| 005 | 20230915 | ||
| 007 | t | ||
| 008 | 900725s1978 d||| |||| 00||| ger d | ||
| 020 | |a 3770511514 |9 3-7705-1151-4 | ||
| 035 | |a (OCoLC)174305790 | ||
| 035 | |a (DE-599)BVBBV003274879 | ||
| 040 | |a DE-604 |b ger |e rakddb | ||
| 041 | 0 | |a ger | |
| 049 | |a DE-384 |a DE-473 |a DE-703 |a DE-739 |a DE-355 |a DE-20 |a DE-824 |a DE-19 |a DE-N32 |a DE-29 |a DE-12 |a DE-83 |a DE-11 |a DE-188 | ||
| 084 | |a ER 100 |0 (DE-625)27714: |2 rvk | ||
| 084 | |a ER 700 |0 (DE-625)27741: |2 rvk | ||
| 100 | 1 | |a Groot, Albert W. de |d 1892-1963 |e Verfasser |0 (DE-588)128209771 |4 aut | |
| 245 | 1 | 0 | |a Die Hierarchie im System der Sprache |b Werkauswahl mit Einleitung und Bibliographie |c A. W. de Groot. Hrsg. von G. F. Bos |
| 264 | 1 | |a München |b Fink |c 1978 | |
| 300 | |a 315 S. |b graph. Darst. | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 1 | |a Internationale Bibliothek für allgemeine Linguistik |v 35 | |
| 650 | 0 | 7 | |a Sprache |0 (DE-588)4056449-6 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Sprachtheorie |0 (DE-588)4121708-1 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Hierarchie |0 (DE-588)4024842-2 |2 gnd |9 rswk-swf |
| 689 | 0 | 0 | |a Sprachtheorie |0 (DE-588)4121708-1 |D s |
| 689 | 0 | |5 DE-604 | |
| 689 | 1 | 0 | |a Sprache |0 (DE-588)4056449-6 |D s |
| 689 | 1 | |5 DE-604 | |
| 689 | 2 | 0 | |a Sprache |0 (DE-588)4056449-6 |D s |
| 689 | 2 | 1 | |a Hierarchie |0 (DE-588)4024842-2 |D s |
| 689 | 2 | |5 DE-604 | |
| 700 | 1 | |a Bos, Gijsbertha Frederika |4 edt | |
| 830 | 0 | |a Internationale Bibliothek für allgemeine Linguistik |v 35 |w (DE-604)BV000003533 |9 35 | |
| 856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=002062729&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-002062729 | ||
| 980 | 4 | |a (DE-12)AK8590057 | |
| 980 | 4 | |a (DE-12)AK08590058 | |
| 980 | 4 | |a (DE-12)AK02880017 | |
| 980 | 4 | |a (DE-12)AK02880018 | |
Datensatz im Suchindex
| _version_ | 1804117621411414016 |
|---|---|
| adam_text | INHALTSVERZEICHNIS
Einleitung 6
Phonologie und Phonetik als Funktionswissenschaften .... 31
Zur Grundlegung der Morphologie und der Syntax 63
Les oppositions dans le Systeme de la syntaxe et des cas .... 93
Structural Linguistics and Syntactic Laws 115
Auslese aus: Structurele Syntaxis 127
Classification of Cases and Uses of Cases 167
Classification of the Uses of a Case. Illustrated on the Genetive
in Latin 175
Auslese aus: Inleiding tot de Algemene Taalwetenschap . . . 235
Schriftenverzeichnis 307
Literaturverzeichnis 312
Nachweis der Erstveröffentlichungen 315
|
| any_adam_object | 1 |
| author | Groot, Albert W. de 1892-1963 |
| author2 | Bos, Gijsbertha Frederika |
| author2_role | edt |
| author2_variant | g f b gf gfb |
| author_GND | (DE-588)128209771 |
| author_facet | Groot, Albert W. de 1892-1963 Bos, Gijsbertha Frederika |
| author_role | aut |
| author_sort | Groot, Albert W. de 1892-1963 |
| author_variant | a w d g awd awdg |
| building | Verbundindex |
| bvnumber | BV003274879 |
| classification_rvk | ER 100 ER 700 |
| ctrlnum | (OCoLC)174305790 (DE-599)BVBBV003274879 |
| discipline | Sprachwissenschaft Literaturwissenschaft |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>02028nam a2200493 cb4500</leader><controlfield tag="001">BV003274879</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20230915 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">900725s1978 d||| |||| 00||| ger d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3770511514</subfield><subfield code="9">3-7705-1151-4</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)174305790</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV003274879</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakddb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">ger</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-384</subfield><subfield code="a">DE-473</subfield><subfield code="a">DE-703</subfield><subfield code="a">DE-739</subfield><subfield code="a">DE-355</subfield><subfield code="a">DE-20</subfield><subfield code="a">DE-824</subfield><subfield code="a">DE-19</subfield><subfield code="a">DE-N32</subfield><subfield code="a">DE-29</subfield><subfield code="a">DE-12</subfield><subfield code="a">DE-83</subfield><subfield code="a">DE-11</subfield><subfield code="a">DE-188</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">ER 100</subfield><subfield code="0">(DE-625)27714:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">ER 700</subfield><subfield code="0">(DE-625)27741:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Groot, Albert W. de</subfield><subfield code="d">1892-1963</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)128209771</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Die Hierarchie im System der Sprache</subfield><subfield code="b">Werkauswahl mit Einleitung und Bibliographie</subfield><subfield code="c">A. W. de Groot. Hrsg. von G. F. Bos</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">München</subfield><subfield code="b">Fink</subfield><subfield code="c">1978</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">315 S.</subfield><subfield code="b">graph. Darst.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Internationale Bibliothek für allgemeine Linguistik</subfield><subfield code="v">35</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Sprache</subfield><subfield code="0">(DE-588)4056449-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Sprachtheorie</subfield><subfield code="0">(DE-588)4121708-1</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Hierarchie</subfield><subfield code="0">(DE-588)4024842-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Sprachtheorie</subfield><subfield code="0">(DE-588)4121708-1</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="1" ind2="0"><subfield code="a">Sprache</subfield><subfield code="0">(DE-588)4056449-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="2" ind2="0"><subfield code="a">Sprache</subfield><subfield code="0">(DE-588)4056449-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="2" ind2="1"><subfield code="a">Hierarchie</subfield><subfield code="0">(DE-588)4024842-2</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="2" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Bos, Gijsbertha Frederika</subfield><subfield code="4">edt</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Internationale Bibliothek für allgemeine Linguistik</subfield><subfield code="v">35</subfield><subfield code="w">(DE-604)BV000003533</subfield><subfield code="9">35</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=002062729&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-002062729</subfield></datafield><datafield tag="980" ind1="4" ind2=" "><subfield code="a">(DE-12)AK8590057</subfield></datafield><datafield tag="980" ind1="4" ind2=" "><subfield code="a">(DE-12)AK08590058</subfield></datafield><datafield tag="980" ind1="4" ind2=" "><subfield code="a">(DE-12)AK02880017</subfield></datafield><datafield tag="980" ind1="4" ind2=" "><subfield code="a">(DE-12)AK02880018</subfield></datafield></record></collection> |
| id | DE-604.BV003274879 |
| illustrated | Illustrated |
| indexdate | 2024-07-09T15:57:19Z |
| institution | BVB |
| isbn | 3770511514 |
| language | German |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-002062729 |
| oclc_num | 174305790 |
| open_access_boolean | |
| owner | DE-384 DE-473 DE-BY-UBG DE-703 DE-739 DE-355 DE-BY-UBR DE-20 DE-824 DE-19 DE-BY-UBM DE-N32 DE-29 DE-12 DE-83 DE-11 DE-188 |
| owner_facet | DE-384 DE-473 DE-BY-UBG DE-703 DE-739 DE-355 DE-BY-UBR DE-20 DE-824 DE-19 DE-BY-UBM DE-N32 DE-29 DE-12 DE-83 DE-11 DE-188 |
| physical | 315 S. graph. Darst. |
| publishDate | 1978 |
| publishDateSearch | 1978 |
| publishDateSort | 1978 |
| publisher | Fink |
| record_format | marc |
| series | Internationale Bibliothek für allgemeine Linguistik |
| series2 | Internationale Bibliothek für allgemeine Linguistik |
| spelling | Groot, Albert W. de 1892-1963 Verfasser (DE-588)128209771 aut Die Hierarchie im System der Sprache Werkauswahl mit Einleitung und Bibliographie A. W. de Groot. Hrsg. von G. F. Bos München Fink 1978 315 S. graph. Darst. txt rdacontent n rdamedia nc rdacarrier Internationale Bibliothek für allgemeine Linguistik 35 Sprache (DE-588)4056449-6 gnd rswk-swf Sprachtheorie (DE-588)4121708-1 gnd rswk-swf Hierarchie (DE-588)4024842-2 gnd rswk-swf Sprachtheorie (DE-588)4121708-1 s DE-604 Sprache (DE-588)4056449-6 s Hierarchie (DE-588)4024842-2 s Bos, Gijsbertha Frederika edt Internationale Bibliothek für allgemeine Linguistik 35 (DE-604)BV000003533 35 HBZ Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=002062729&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Groot, Albert W. de 1892-1963 Die Hierarchie im System der Sprache Werkauswahl mit Einleitung und Bibliographie Internationale Bibliothek für allgemeine Linguistik Sprache (DE-588)4056449-6 gnd Sprachtheorie (DE-588)4121708-1 gnd Hierarchie (DE-588)4024842-2 gnd |
| subject_GND | (DE-588)4056449-6 (DE-588)4121708-1 (DE-588)4024842-2 |
| title | Die Hierarchie im System der Sprache Werkauswahl mit Einleitung und Bibliographie |
| title_auth | Die Hierarchie im System der Sprache Werkauswahl mit Einleitung und Bibliographie |
| title_exact_search | Die Hierarchie im System der Sprache Werkauswahl mit Einleitung und Bibliographie |
| title_full | Die Hierarchie im System der Sprache Werkauswahl mit Einleitung und Bibliographie A. W. de Groot. Hrsg. von G. F. Bos |
| title_fullStr | Die Hierarchie im System der Sprache Werkauswahl mit Einleitung und Bibliographie A. W. de Groot. Hrsg. von G. F. Bos |
| title_full_unstemmed | Die Hierarchie im System der Sprache Werkauswahl mit Einleitung und Bibliographie A. W. de Groot. Hrsg. von G. F. Bos |
| title_short | Die Hierarchie im System der Sprache |
| title_sort | die hierarchie im system der sprache werkauswahl mit einleitung und bibliographie |
| title_sub | Werkauswahl mit Einleitung und Bibliographie |
| topic | Sprache (DE-588)4056449-6 gnd Sprachtheorie (DE-588)4121708-1 gnd Hierarchie (DE-588)4024842-2 gnd |
| topic_facet | Sprache Sprachtheorie Hierarchie |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=002062729&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| volume_link | (DE-604)BV000003533 |
| work_keys_str_mv | AT grootalbertwde diehierarchieimsystemdersprachewerkauswahlmiteinleitungundbibliographie AT bosgijsberthafrederika diehierarchieimsystemdersprachewerkauswahlmiteinleitungundbibliographie |