Internformat: Solid State Science and Technology VI :

Solid State Science and Technology VI :: Selected, peer reviewed papers from the 6th International Conference on Solid State Science and Technology (6th ICSSST), November 13-16, 2017, Penang, Malaysia /

This volume was collected on the results of the 6th International Conference on Solid State Science and Technology (ICSSST2017, 13 - 16 November 2017, Penang, Malaysia) and the main objective of this volume is to present the latest findings of researches on solid-state science and technology in all...

Ausführliche Beschreibung

Gespeichert in:

Bibliographische Detailangaben
Weitere Verfasser:	Iskandar, S. M. (HerausgeberIn), Saiful, Najmee Mohamad (HerausgeberIn), Faris, Hidayat Ahmad Suhaimi (HerausgeberIn)
Format:	Elektronisch E-Book
Sprache:	English
Veröffentlicht:	Switzerland : Trans Tech Publications Ltd, 2019.
Schriftenreihe:	Solid State Phenomena Ser.
Schlagworte:	Solid state physics > Congresses. Solid state electronics > Congresses. Materials science > Congresses. Physique de l'état solide > Congrès. Électronique de l'état solide > Congrès. Science des matériaux > Congrès. Materials science Solid state electronics Solid state physics Conference papers and proceedings
Online-Zugang:	Volltext
Zusammenfassung:	This volume was collected on the results of the 6th International Conference on Solid State Science and Technology (ICSSST2017, 13 - 16 November 2017, Penang, Malaysia) and the main objective of this volume is to present the latest findings of researches on solid-state science and technology in all aspects of physical and chemical properties, preparation and characterization techniques, optical properties; macro-, micro- and nanostructures. We hope this book will be useful for many engineers and researchers in the area of materials science. Glass, Ceramics, Graphene, Graphite, Nanoparticles, Semiconductors, Superconductors, Polymers, Composites, Nanofluid, Nanomaterials, Solid-State Sensors Materials Science, Nanoscience.
Beschreibung:	1 online resource (364 pages) : illustrations
Bibliographie:	Includes bibliographical references and index.
ISBN:	9783035734522 3035734526

Internformat

MARC


LEADER	00000cam a2200000 i 4500
001	ZDB-4-EBA-on1155202762
003	OCoLC
005	20240705115654.0
006	m o d
007	cr cnu---unuuu
008	200522s2019 sz ad fob 001 0 eng d
040			\|a N$T \|b eng \|e rda \|e pn \|c N$T \|d OCLCF \|d EBLCP \|d OCLCQ \|d OCLCO \|d OCLCQ \|d OCLCO \|d OCLCL
019			\|a 1193122001
020			\|a 9783035734522 \|q (electronic bk.)
020			\|a 3035734526 \|q (electronic bk.)
020			\|z 9783035712728
020			\|z 3035712727
035			\|a (OCoLC)1155202762 \|z (OCoLC)1193122001
050		4	\|a QC176.A1
082	7		\|a 530.41 \|2 23
049			\|a MAIN
245	0	0	\|a Solid State Science and Technology VI : \|b Selected, peer reviewed papers from the 6th International Conference on Solid State Science and Technology (6th ICSSST), November 13-16, 2017, Penang, Malaysia / \|c edited by S.M. Iskandar, Najmee Mohamad Saiful and Hidayat Ahmad Suhaimi Faris.
264		1	\|a Switzerland : \|b Trans Tech Publications Ltd, \|c 2019.
300			\|a 1 online resource (364 pages) : \|b illustrations
336			\|a text \|b txt \|2 rdacontent
337			\|a computer \|b c \|2 rdamedia
338			\|a online resource \|b cr \|2 rdacarrier
365			\|a 41 \|b 230.00 \|c USD \|d 00 \|2 onixpt
365			\|a 41 \|b 210.00 \|c EUR \|d 00 \|2 onixpt
365			\|a 41 \|b 185.00 \|c GBP \|d 00 \|2 onixpt
490	1		\|a Solid State Phenomena Ser. ; \|v v. Volume 307
504			\|a Includes bibliographical references and index.
520			\|a This volume was collected on the results of the 6th International Conference on Solid State Science and Technology (ICSSST2017, 13 - 16 November 2017, Penang, Malaysia) and the main objective of this volume is to present the latest findings of researches on solid-state science and technology in all aspects of physical and chemical properties, preparation and characterization techniques, optical properties; macro-, micro- and nanostructures. We hope this book will be useful for many engineers and researchers in the area of materials science. Glass, Ceramics, Graphene, Graphite, Nanoparticles, Semiconductors, Superconductors, Polymers, Composites, Nanofluid, Nanomaterials, Solid-State Sensors Materials Science, Nanoscience.
588	0		\|a Print version record.
505	0		\|a Intro -- Solid State Science and Technology XXX -- Preface -- Table of Contents -- Chapter 1: Materials for Application in Electrical Engineering, Electronics and Spintronics -- Investigation of Nano-Sized Al2O3 on Pr-Sr-Mn-O Composites: Structural, Microstructural and Magnetic Properties -- Structural, Magnetic and Magnetotransport Properties of Sol-Gel Synthesized La0.67Ca0.33MnO3:TiO2 Nanocomposite -- Solderability of Coloured Lead Free Solder Composite -- A Study of Multiferroic BiFeO3/Epoxy Resin Composite as Potential Coating Materials for Microwave Absorption
505	8		\|a Morphological Effect on the Intermetallic Compound Layer Growth Kinetics of Metallurgical Joining -- Effect of Blast Wave on Intermetallics Formation, Hardness and Reduced Modulus Properties of Solder Joints -- The Effect of Various ZnO Layer towards Sensing Performance as an Electrolyte-Insulator-Semiconductor pH Sensor -- The Study of a Structural and Electronic Properties of Two-Dimensional Flat Layer Arsenene Using Planewaves Density Functional Calculation -- Zinc Oxide Thin Film Synthesized by Sol-Gel Method
505	8		\|a Synthesis and Characterization of Cobalt Ferrite Nanoparticles via Sol-Gel Auto Combustion Method -- Self-Catalysed Vapor-Liquid-Solid Growth Mechanism of ZnO Nanowires Grown on Silicon Substrate Pre-Coated with ZnO Buffer Layer -- ZnO Coated Optical Fiber for Alcohol Sensing Applications -- Graphene Based Macrobend Unclad SMF for Monitoring pH Level in Aqueous Environment -- Plastic Optical Fiber Sensor for Detection of Ethanol Concentrations -- Chapter 2: Superconducting Materials -- Electrospinning Synthesis of Bi-2223 Superconducting Nanowires
505	8		\|a Effect of Ni0.5Zn0.5Fe2O4 Nanoparticles Addition on Tl-1212 High Temperature Superconductor -- Effect of CeO2 Nanoparticle on the Structural and Electrical Properties of BSCCO-2223 High Temperature Superconductor -- Chapter 3: Materials and Technologies for Application in Energy Storage -- Effect on Electrochemical Performance of Cr and Ni Substitution in LiCoO2 Cathode Materials -- Structural Studies and Ionic Transport Properties of Solid Biopolymer Electrolytes Based on Chitosan/ Methyl Cellulose Blend Doped with BMIMTFSI
650		0	\|a Solid state physics \|v Congresses.
650		0	\|a Solid state electronics \|v Congresses.
650		0	\|a Materials science \|v Congresses.
650		6	\|a Physique de l'état solide \|v Congrès.
650		6	\|a Électronique de l'état solide \|v Congrès.
650		6	\|a Science des matériaux \|v Congrès.
650		7	\|a Materials science \|2 fast
650		7	\|a Solid state electronics \|2 fast
650		7	\|a Solid state physics \|2 fast
655		7	\|a Conference papers and proceedings \|2 fast
700	1		\|a Iskandar, S. M., \|e editor.
700	1		\|a Saiful, Najmee Mohamad, \|e editor.
700	1		\|a Faris, Hidayat Ahmad Suhaimi, \|e editor.
758			\|i has work: \|a Solid state science and technology VI (Text) \|1 https://id.oclc.org/worldcat/entity/E39PD3RmJR7vWxCw3kjjY8R4YP \|4 https://id.oclc.org/worldcat/ontology/hasWork
776	0	8	\|i Print version: \|t Solid State Science and Technology VI. \|d Switzerland : Trans Tech Publications Ltd, 2019 \|z 9783035712728 \|w (OCoLC)1145786933
830		0	\|a Solid State Phenomena Ser.
856	1		\|l FWS01 \|p ZDB-4-EBA \|q FWS_PDA_EBA \|u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=2479503 \|3 Volltext
856	1		\|l CBO01 \|p ZDB-4-EBA \|q FWS_PDA_EBA \|u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=2479503 \|3 Volltext
938			\|a ProQuest Ebook Central \|b EBLB \|n EBL6319122
938			\|a EBSCOhost \|b EBSC \|n 2479503
994			\|a 92 \|b GEBAY
912			\|a ZDB-4-EBA

Datensatz im Suchindex

DE-BY-FWS_katkey	ZDB-4-EBA-on1155202762
_version_	1813901679879258112
adam_text
any_adam_object
author2	Iskandar, S. M. Saiful, Najmee Mohamad Faris, Hidayat Ahmad Suhaimi
author2_role	edt edt edt
author2_variant	s m i sm smi n m s nm nms h a s f has hasf
author_facet	Iskandar, S. M. Saiful, Najmee Mohamad Faris, Hidayat Ahmad Suhaimi
building	Verbundindex
bvnumber	localFWS
callnumber-first	Q - Science
callnumber-label	QC176
callnumber-raw	QC176.A1
callnumber-search	QC176.A1
callnumber-sort	QC 3176 A1
callnumber-subject	QC - Physics
collection	ZDB-4-EBA
contents	Intro -- Solid State Science and Technology XXX -- Preface -- Table of Contents -- Chapter 1: Materials for Application in Electrical Engineering, Electronics and Spintronics -- Investigation of Nano-Sized Al2O3 on Pr-Sr-Mn-O Composites: Structural, Microstructural and Magnetic Properties -- Structural, Magnetic and Magnetotransport Properties of Sol-Gel Synthesized La0.67Ca0.33MnO3:TiO2 Nanocomposite -- Solderability of Coloured Lead Free Solder Composite -- A Study of Multiferroic BiFeO3/Epoxy Resin Composite as Potential Coating Materials for Microwave Absorption Morphological Effect on the Intermetallic Compound Layer Growth Kinetics of Metallurgical Joining -- Effect of Blast Wave on Intermetallics Formation, Hardness and Reduced Modulus Properties of Solder Joints -- The Effect of Various ZnO Layer towards Sensing Performance as an Electrolyte-Insulator-Semiconductor pH Sensor -- The Study of a Structural and Electronic Properties of Two-Dimensional Flat Layer Arsenene Using Planewaves Density Functional Calculation -- Zinc Oxide Thin Film Synthesized by Sol-Gel Method Synthesis and Characterization of Cobalt Ferrite Nanoparticles via Sol-Gel Auto Combustion Method -- Self-Catalysed Vapor-Liquid-Solid Growth Mechanism of ZnO Nanowires Grown on Silicon Substrate Pre-Coated with ZnO Buffer Layer -- ZnO Coated Optical Fiber for Alcohol Sensing Applications -- Graphene Based Macrobend Unclad SMF for Monitoring pH Level in Aqueous Environment -- Plastic Optical Fiber Sensor for Detection of Ethanol Concentrations -- Chapter 2: Superconducting Materials -- Electrospinning Synthesis of Bi-2223 Superconducting Nanowires Effect of Ni0.5Zn0.5Fe2O4 Nanoparticles Addition on Tl-1212 High Temperature Superconductor -- Effect of CeO2 Nanoparticle on the Structural and Electrical Properties of BSCCO-2223 High Temperature Superconductor -- Chapter 3: Materials and Technologies for Application in Energy Storage -- Effect on Electrochemical Performance of Cr and Ni Substitution in LiCoO2 Cathode Materials -- Structural Studies and Ionic Transport Properties of Solid Biopolymer Electrolytes Based on Chitosan/ Methyl Cellulose Blend Doped with BMIMTFSI
ctrlnum	(OCoLC)1155202762
dewey-full	530.41
dewey-hundreds	500 - Natural sciences and mathematics
dewey-ones	530 - Physics
dewey-raw	530.41
dewey-search	530.41
dewey-sort	3530.41
dewey-tens	530 - Physics
discipline	Physik
format	Electronic eBook
fullrecord	<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>05688cam a2200661 i 4500</leader><controlfield tag="001">ZDB-4-EBA-on1155202762</controlfield><controlfield tag="003">OCoLC</controlfield><controlfield tag="005">20240705115654.0</controlfield><controlfield tag="006">m o d </controlfield><controlfield tag="007">cr cnu---unuuu</controlfield><controlfield tag="008">200522s2019 sz ad fob 001 0 eng d</controlfield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">N$T</subfield><subfield code="b">eng</subfield><subfield code="e">rda</subfield><subfield code="e">pn</subfield><subfield code="c">N$T</subfield><subfield code="d">OCLCF</subfield><subfield code="d">EBLCP</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCL</subfield></datafield><datafield tag="019" ind1=" " ind2=" "><subfield code="a">1193122001</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783035734522</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3035734526</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">9783035712728</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">3035712727</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1155202762</subfield><subfield code="z">(OCoLC)1193122001</subfield></datafield><datafield tag="050" ind1=" " ind2="4"><subfield code="a">QC176.A1</subfield></datafield><datafield tag="082" ind1="7" ind2=" "><subfield code="a">530.41</subfield><subfield code="2">23</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">MAIN</subfield></datafield><datafield tag="245" ind1="0" ind2="0"><subfield code="a">Solid State Science and Technology VI :</subfield><subfield code="b">Selected, peer reviewed papers from the 6th International Conference on Solid State Science and Technology (6th ICSSST), November 13-16, 2017, Penang, Malaysia /</subfield><subfield code="c">edited by S.M. Iskandar, Najmee Mohamad Saiful and Hidayat Ahmad Suhaimi Faris.</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Switzerland :</subfield><subfield code="b">Trans Tech Publications Ltd,</subfield><subfield code="c">2019.</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (364 pages) :</subfield><subfield code="b">illustrations</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">computer</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">online resource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="365" ind1=" " ind2=" "><subfield code="a">41</subfield><subfield code="b">230.00</subfield><subfield code="c">USD</subfield><subfield code="d">00</subfield><subfield code="2">onixpt</subfield></datafield><datafield tag="365" ind1=" " ind2=" "><subfield code="a">41</subfield><subfield code="b">210.00</subfield><subfield code="c">EUR</subfield><subfield code="d">00</subfield><subfield code="2">onixpt</subfield></datafield><datafield tag="365" ind1=" " ind2=" "><subfield code="a">41</subfield><subfield code="b">185.00</subfield><subfield code="c">GBP</subfield><subfield code="d">00</subfield><subfield code="2">onixpt</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Solid State Phenomena Ser. ;</subfield><subfield code="v">v. Volume 307</subfield></datafield><datafield tag="504" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references and index.</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">This volume was collected on the results of the 6th International Conference on Solid State Science and Technology (ICSSST2017, 13 - 16 November 2017, Penang, Malaysia) and the main objective of this volume is to present the latest findings of researches on solid-state science and technology in all aspects of physical and chemical properties, preparation and characterization techniques, optical properties; macro-, micro- and nanostructures. We hope this book will be useful for many engineers and researchers in the area of materials science. Glass, Ceramics, Graphene, Graphite, Nanoparticles, Semiconductors, Superconductors, Polymers, Composites, Nanofluid, Nanomaterials, Solid-State Sensors Materials Science, Nanoscience.</subfield></datafield><datafield tag="588" ind1="0" ind2=" "><subfield code="a">Print version record.</subfield></datafield><datafield tag="505" ind1="0" ind2=" "><subfield code="a">Intro -- Solid State Science and Technology XXX -- Preface -- Table of Contents -- Chapter 1: Materials for Application in Electrical Engineering, Electronics and Spintronics -- Investigation of Nano-Sized Al2O3 on Pr-Sr-Mn-O Composites: Structural, Microstructural and Magnetic Properties -- Structural, Magnetic and Magnetotransport Properties of Sol-Gel Synthesized La0.67Ca0.33MnO3:TiO2 Nanocomposite -- Solderability of Coloured Lead Free Solder Composite -- A Study of Multiferroic BiFeO3/Epoxy Resin Composite as Potential Coating Materials for Microwave Absorption</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Morphological Effect on the Intermetallic Compound Layer Growth Kinetics of Metallurgical Joining -- Effect of Blast Wave on Intermetallics Formation, Hardness and Reduced Modulus Properties of Solder Joints -- The Effect of Various ZnO Layer towards Sensing Performance as an Electrolyte-Insulator-Semiconductor pH Sensor -- The Study of a Structural and Electronic Properties of Two-Dimensional Flat Layer Arsenene Using Planewaves Density Functional Calculation -- Zinc Oxide Thin Film Synthesized by Sol-Gel Method</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Synthesis and Characterization of Cobalt Ferrite Nanoparticles via Sol-Gel Auto Combustion Method -- Self-Catalysed Vapor-Liquid-Solid Growth Mechanism of ZnO Nanowires Grown on Silicon Substrate Pre-Coated with ZnO Buffer Layer -- ZnO Coated Optical Fiber for Alcohol Sensing Applications -- Graphene Based Macrobend Unclad SMF for Monitoring pH Level in Aqueous Environment -- Plastic Optical Fiber Sensor for Detection of Ethanol Concentrations -- Chapter 2: Superconducting Materials -- Electrospinning Synthesis of Bi-2223 Superconducting Nanowires</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Effect of Ni0.5Zn0.5Fe2O4 Nanoparticles Addition on Tl-1212 High Temperature Superconductor -- Effect of CeO2 Nanoparticle on the Structural and Electrical Properties of BSCCO-2223 High Temperature Superconductor -- Chapter 3: Materials and Technologies for Application in Energy Storage -- Effect on Electrochemical Performance of Cr and Ni Substitution in LiCoO2 Cathode Materials -- Structural Studies and Ionic Transport Properties of Solid Biopolymer Electrolytes Based on Chitosan/ Methyl Cellulose Blend Doped with BMIMTFSI</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Solid state physics</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Solid state electronics</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Materials science</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Physique de l'état solide</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Électronique de l'état solide</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Science des matériaux</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Materials science</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Solid state electronics</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Solid state physics</subfield><subfield code="2">fast</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">Conference papers and proceedings</subfield><subfield code="2">fast</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Iskandar, S. M.,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Saiful, Najmee Mohamad,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Faris, Hidayat Ahmad Suhaimi,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="758" ind1=" " ind2=" "><subfield code="i">has work:</subfield><subfield code="a">Solid state science and technology VI (Text)</subfield><subfield code="1">https://id.oclc.org/worldcat/entity/E39PD3RmJR7vWxCw3kjjY8R4YP</subfield><subfield code="4">https://id.oclc.org/worldcat/ontology/hasWork</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Print version:</subfield><subfield code="t">Solid State Science and Technology VI.</subfield><subfield code="d">Switzerland : Trans Tech Publications Ltd, 2019</subfield><subfield code="z">9783035712728</subfield><subfield code="w">(OCoLC)1145786933</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Solid State Phenomena Ser.</subfield></datafield><datafield tag="856" ind1="1" ind2=" "><subfield code="l">FWS01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=2479503</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="856" ind1="1" ind2=" "><subfield code="l">CBO01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=2479503</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">ProQuest Ebook Central</subfield><subfield code="b">EBLB</subfield><subfield code="n">EBL6319122</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">EBSCOhost</subfield><subfield code="b">EBSC</subfield><subfield code="n">2479503</subfield></datafield><datafield tag="994" ind1=" " ind2=" "><subfield code="a">92</subfield><subfield code="b">GEBAY</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield></record></collection>
genre	Conference papers and proceedings fast
genre_facet	Conference papers and proceedings
id	ZDB-4-EBA-on1155202762
illustrated	Illustrated
indexdate	2024-10-25T15:50:44Z
institution	BVB
isbn	9783035734522 3035734526
language	English
oclc_num	1155202762
open_access_boolean
owner	MAIN
owner_facet	MAIN
physical	1 online resource (364 pages) : illustrations
psigel	ZDB-4-EBA
publishDate	2019
publishDateSearch	2019
publishDateSort	2019
publisher	Trans Tech Publications Ltd,
record_format	marc
series	Solid State Phenomena Ser.
series2	Solid State Phenomena Ser. ;
spelling	Solid State Science and Technology VI : Selected, peer reviewed papers from the 6th International Conference on Solid State Science and Technology (6th ICSSST), November 13-16, 2017, Penang, Malaysia / edited by S.M. Iskandar, Najmee Mohamad Saiful and Hidayat Ahmad Suhaimi Faris. Switzerland : Trans Tech Publications Ltd, 2019. 1 online resource (364 pages) : illustrations text txt rdacontent computer c rdamedia online resource cr rdacarrier 41 230.00 USD 00 onixpt 41 210.00 EUR 00 onixpt 41 185.00 GBP 00 onixpt Solid State Phenomena Ser. ; v. Volume 307 Includes bibliographical references and index. This volume was collected on the results of the 6th International Conference on Solid State Science and Technology (ICSSST2017, 13 - 16 November 2017, Penang, Malaysia) and the main objective of this volume is to present the latest findings of researches on solid-state science and technology in all aspects of physical and chemical properties, preparation and characterization techniques, optical properties; macro-, micro- and nanostructures. We hope this book will be useful for many engineers and researchers in the area of materials science. Glass, Ceramics, Graphene, Graphite, Nanoparticles, Semiconductors, Superconductors, Polymers, Composites, Nanofluid, Nanomaterials, Solid-State Sensors Materials Science, Nanoscience. Print version record. Intro -- Solid State Science and Technology XXX -- Preface -- Table of Contents -- Chapter 1: Materials for Application in Electrical Engineering, Electronics and Spintronics -- Investigation of Nano-Sized Al2O3 on Pr-Sr-Mn-O Composites: Structural, Microstructural and Magnetic Properties -- Structural, Magnetic and Magnetotransport Properties of Sol-Gel Synthesized La0.67Ca0.33MnO3:TiO2 Nanocomposite -- Solderability of Coloured Lead Free Solder Composite -- A Study of Multiferroic BiFeO3/Epoxy Resin Composite as Potential Coating Materials for Microwave Absorption Morphological Effect on the Intermetallic Compound Layer Growth Kinetics of Metallurgical Joining -- Effect of Blast Wave on Intermetallics Formation, Hardness and Reduced Modulus Properties of Solder Joints -- The Effect of Various ZnO Layer towards Sensing Performance as an Electrolyte-Insulator-Semiconductor pH Sensor -- The Study of a Structural and Electronic Properties of Two-Dimensional Flat Layer Arsenene Using Planewaves Density Functional Calculation -- Zinc Oxide Thin Film Synthesized by Sol-Gel Method Synthesis and Characterization of Cobalt Ferrite Nanoparticles via Sol-Gel Auto Combustion Method -- Self-Catalysed Vapor-Liquid-Solid Growth Mechanism of ZnO Nanowires Grown on Silicon Substrate Pre-Coated with ZnO Buffer Layer -- ZnO Coated Optical Fiber for Alcohol Sensing Applications -- Graphene Based Macrobend Unclad SMF for Monitoring pH Level in Aqueous Environment -- Plastic Optical Fiber Sensor for Detection of Ethanol Concentrations -- Chapter 2: Superconducting Materials -- Electrospinning Synthesis of Bi-2223 Superconducting Nanowires Effect of Ni0.5Zn0.5Fe2O4 Nanoparticles Addition on Tl-1212 High Temperature Superconductor -- Effect of CeO2 Nanoparticle on the Structural and Electrical Properties of BSCCO-2223 High Temperature Superconductor -- Chapter 3: Materials and Technologies for Application in Energy Storage -- Effect on Electrochemical Performance of Cr and Ni Substitution in LiCoO2 Cathode Materials -- Structural Studies and Ionic Transport Properties of Solid Biopolymer Electrolytes Based on Chitosan/ Methyl Cellulose Blend Doped with BMIMTFSI Solid state physics Congresses. Solid state electronics Congresses. Materials science Congresses. Physique de l'état solide Congrès. Électronique de l'état solide Congrès. Science des matériaux Congrès. Materials science fast Solid state electronics fast Solid state physics fast Conference papers and proceedings fast Iskandar, S. M., editor. Saiful, Najmee Mohamad, editor. Faris, Hidayat Ahmad Suhaimi, editor. has work: Solid state science and technology VI (Text) https://id.oclc.org/worldcat/entity/E39PD3RmJR7vWxCw3kjjY8R4YP https://id.oclc.org/worldcat/ontology/hasWork Print version: Solid State Science and Technology VI. Switzerland : Trans Tech Publications Ltd, 2019 9783035712728 (OCoLC)1145786933 Solid State Phenomena Ser. FWS01 ZDB-4-EBA FWS_PDA_EBA https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=2479503 Volltext CBO01 ZDB-4-EBA FWS_PDA_EBA https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=2479503 Volltext
spellingShingle	Solid State Science and Technology VI : Selected, peer reviewed papers from the 6th International Conference on Solid State Science and Technology (6th ICSSST), November 13-16, 2017, Penang, Malaysia / Solid State Phenomena Ser. Intro -- Solid State Science and Technology XXX -- Preface -- Table of Contents -- Chapter 1: Materials for Application in Electrical Engineering, Electronics and Spintronics -- Investigation of Nano-Sized Al2O3 on Pr-Sr-Mn-O Composites: Structural, Microstructural and Magnetic Properties -- Structural, Magnetic and Magnetotransport Properties of Sol-Gel Synthesized La0.67Ca0.33MnO3:TiO2 Nanocomposite -- Solderability of Coloured Lead Free Solder Composite -- A Study of Multiferroic BiFeO3/Epoxy Resin Composite as Potential Coating Materials for Microwave Absorption Morphological Effect on the Intermetallic Compound Layer Growth Kinetics of Metallurgical Joining -- Effect of Blast Wave on Intermetallics Formation, Hardness and Reduced Modulus Properties of Solder Joints -- The Effect of Various ZnO Layer towards Sensing Performance as an Electrolyte-Insulator-Semiconductor pH Sensor -- The Study of a Structural and Electronic Properties of Two-Dimensional Flat Layer Arsenene Using Planewaves Density Functional Calculation -- Zinc Oxide Thin Film Synthesized by Sol-Gel Method Synthesis and Characterization of Cobalt Ferrite Nanoparticles via Sol-Gel Auto Combustion Method -- Self-Catalysed Vapor-Liquid-Solid Growth Mechanism of ZnO Nanowires Grown on Silicon Substrate Pre-Coated with ZnO Buffer Layer -- ZnO Coated Optical Fiber for Alcohol Sensing Applications -- Graphene Based Macrobend Unclad SMF for Monitoring pH Level in Aqueous Environment -- Plastic Optical Fiber Sensor for Detection of Ethanol Concentrations -- Chapter 2: Superconducting Materials -- Electrospinning Synthesis of Bi-2223 Superconducting Nanowires Effect of Ni0.5Zn0.5Fe2O4 Nanoparticles Addition on Tl-1212 High Temperature Superconductor -- Effect of CeO2 Nanoparticle on the Structural and Electrical Properties of BSCCO-2223 High Temperature Superconductor -- Chapter 3: Materials and Technologies for Application in Energy Storage -- Effect on Electrochemical Performance of Cr and Ni Substitution in LiCoO2 Cathode Materials -- Structural Studies and Ionic Transport Properties of Solid Biopolymer Electrolytes Based on Chitosan/ Methyl Cellulose Blend Doped with BMIMTFSI Solid state physics Congresses. Solid state electronics Congresses. Materials science Congresses. Physique de l'état solide Congrès. Électronique de l'état solide Congrès. Science des matériaux Congrès. Materials science fast Solid state electronics fast Solid state physics fast
title	Solid State Science and Technology VI : Selected, peer reviewed papers from the 6th International Conference on Solid State Science and Technology (6th ICSSST), November 13-16, 2017, Penang, Malaysia /
title_auth	Solid State Science and Technology VI : Selected, peer reviewed papers from the 6th International Conference on Solid State Science and Technology (6th ICSSST), November 13-16, 2017, Penang, Malaysia /
title_exact_search	Solid State Science and Technology VI : Selected, peer reviewed papers from the 6th International Conference on Solid State Science and Technology (6th ICSSST), November 13-16, 2017, Penang, Malaysia /
title_full	Solid State Science and Technology VI : Selected, peer reviewed papers from the 6th International Conference on Solid State Science and Technology (6th ICSSST), November 13-16, 2017, Penang, Malaysia / edited by S.M. Iskandar, Najmee Mohamad Saiful and Hidayat Ahmad Suhaimi Faris.
title_fullStr	Solid State Science and Technology VI : Selected, peer reviewed papers from the 6th International Conference on Solid State Science and Technology (6th ICSSST), November 13-16, 2017, Penang, Malaysia / edited by S.M. Iskandar, Najmee Mohamad Saiful and Hidayat Ahmad Suhaimi Faris.
title_full_unstemmed	Solid State Science and Technology VI : Selected, peer reviewed papers from the 6th International Conference on Solid State Science and Technology (6th ICSSST), November 13-16, 2017, Penang, Malaysia / edited by S.M. Iskandar, Najmee Mohamad Saiful and Hidayat Ahmad Suhaimi Faris.
title_short	Solid State Science and Technology VI :
title_sort	solid state science and technology vi selected peer reviewed papers from the 6th international conference on solid state science and technology 6th icssst november 13 16 2017 penang malaysia
title_sub	Selected, peer reviewed papers from the 6th International Conference on Solid State Science and Technology (6th ICSSST), November 13-16, 2017, Penang, Malaysia /
topic	Solid state physics Congresses. Solid state electronics Congresses. Materials science Congresses. Physique de l'état solide Congrès. Électronique de l'état solide Congrès. Science des matériaux Congrès. Materials science fast Solid state electronics fast Solid state physics fast
topic_facet	Solid state physics Congresses. Solid state electronics Congresses. Materials science Congresses. Physique de l'état solide Congrès. Électronique de l'état solide Congrès. Science des matériaux Congrès. Materials science Solid state electronics Solid state physics Conference papers and proceedings
url	https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=2479503
work_keys_str_mv	AT iskandarsm solidstatescienceandtechnologyviselectedpeerreviewedpapersfromthe6thinternationalconferenceonsolidstatescienceandtechnology6thicssstnovember13162017penangmalaysia AT saifulnajmeemohamad solidstatescienceandtechnologyviselectedpeerreviewedpapersfromthe6thinternationalconferenceonsolidstatescienceandtechnology6thicssstnovember13162017penangmalaysia AT farishidayatahmadsuhaimi solidstatescienceandtechnologyviselectedpeerreviewedpapersfromthe6thinternationalconferenceonsolidstatescienceandtechnology6thicssstnovember13162017penangmalaysia

Verfügbarkeit

MARC

Datensatz im Suchindex

Ähnliche Einträge