Internformat: Advancement of materials and nanotechnology II :

Advancement of materials and nanotechnology II :: selected, peer reviewed papers from the International Conference on the Advancement of Materials and Nanotechnology (ICAMN III 2013), November 19-21,2013, Kuala Lumpur, Malaysia /

Collection of selected, peer reviewed papers from the 3rd International Conference on the Advancement of Materials and Nanotechnology 2013 (ICAMN III 2013), November 19-21, 2013, Penang. The 94 papers are grouped as follows: Chapter 1: Nanomaterial Research and Application, Chapter 2: Polymer Materi...

Ausführliche Beschreibung

Gespeichert in:

Bibliographische Detailangaben
Körperschaft:	International Conference on the Advancement of Materials and Nanotechnology Penang
Weitere Verfasser:	Cheong, Kuan Yew
Format:	Elektronisch Tagungsbericht E-Book
Sprache:	English
Veröffentlicht:	Pfaffikon : Trans Tech Publications, [2014]
Schriftenreihe:	Advanced materials research ; v. 1024.
Schlagworte:	Nanostructured materials > Congresses. Nanotechnology > Congresses. Materials > Congresses. Nanomatériaux > Congrès. Matériaux > Congrès. Nanotechnologie > Congrès. TECHNOLOGY & ENGINEERING > Engineering (General) TECHNOLOGY & ENGINEERING > Reference. Materials Nanostructured materials Nanotechnology Conference papers and proceedings
Online-Zugang:	Volltext
Zusammenfassung:	Collection of selected, peer reviewed papers from the 3rd International Conference on the Advancement of Materials and Nanotechnology 2013 (ICAMN III 2013), November 19-21, 2013, Penang. The 94 papers are grouped as follows: Chapter 1: Nanomaterial Research and Application, Chapter 2: Polymer Materials and Composites, Chapter 3: Functional and Structural Materials, Material Processing Technologies, Chapter 4: Micro/Nano Materials for Bio/Medical Application, Chapter 5: Materials and Technologies for Electric and Electronic Application Temporary description, more details to follow.
Beschreibung:	1 online resource
Bibliographie:	Includes bibliographical references and index.
ISBN:	9783038265962 3038265969
ISSN:	1022-6680 ;

Internformat

MARC


LEADER	00000cam a2200000 i 4500
001	ZDB-4-EBA-ocn890407032
003	OCoLC
005	20241004212047.0
006	m o d
007	cr cnu---unuuu
008	140911s2014 sz ob 101 0 eng d
040			\|a N$T \|b eng \|e rda \|e pn \|c N$T \|d EBLCP \|d YDXCP \|d OCLCF \|d DEBSZ \|d OCLCO \|d OCLCQ \|d OCLCO \|d OCL \|d OCLCQ \|d OCL \|d OCLCO \|d OCLCQ \|d DEBBG \|d AGLDB \|d ZCU \|d MERUC \|d OCLCQ \|d VTS \|d ICG \|d OCLCQ \|d STF \|d DKC \|d AU@ \|d OCLCQ \|d M8D \|d OCL \|d OCLCQ \|d AJS \|d OCLCQ \|d OCLCO \|d SGP \|d OCLCQ \|d OCLCO
020			\|a 9783038265962 \|q (electronic bk.)
020			\|a 3038265969 \|q (electronic bk.)
035			\|a (OCoLC)890407032
050		4	\|a TA418.9.N35
072		7	\|a TEC \|x 021000 \|2 bisacsh
072		7	\|a TEC \|x 009000 \|2 bisacsh
072		7	\|a TEC \|x 035000 \|2 bisacsh
082	7		\|a 620.1/15 \|2 23
049			\|a MAIN
111	2		\|a International Conference on the Advancement of Materials and Nanotechnology \|n (3rd : \|d 2013 : \|c Penang)
245	1	0	\|a Advancement of materials and nanotechnology II : \|b selected, peer reviewed papers from the International Conference on the Advancement of Materials and Nanotechnology (ICAMN III 2013), November 19-21,2013, Kuala Lumpur, Malaysia / \|c edited by Kuan Yew Cheong andn [five others].
264		1	\|a Pfaffikon : \|b Trans Tech Publications, \|c [2014]
264		4	\|c ©2014
300			\|a 1 online resource
336			\|a text \|b txt \|2 rdacontent
337			\|a computer \|b c \|2 rdamedia
338			\|a online resource \|b cr \|2 rdacarrier
490	1		\|a Advanced materials research, \|x 1022-6680 ; \|v v. 1024
504			\|a Includes bibliographical references and index.
505	0		\|a Advancement of Materials and Nanotechnology III; Preface and Committees; Table of Contents; Chapter 1: Nanomaterial Research and Application; Design and Synthesis Silica-Polyelectrolyte-Iron Oxide Nanocomposite with Magnetic-Catalytic Bifunctionalities for Dye Removal; Effect of Calcination Temperature on the Morphological and Phase Structure of Hydrothermally Synthesized Copper Ion Doped TiO2 Nanotubes; Nanoclay for Micropollutant Removal in Wastewater-Effective Alternative?; S-Parameters of Bismuth Iron Garnet (BIG) Filled Polyvinylidene Fluoride Composite Using Rectangular Waveguide Method
505	8		\|a Controlled Growth of ZnO Nanoparticles with Different Morphologies Using Sol-Gel TechniqueImproving the Production of Self-Assembled ZnS:Mn Nanocrystals through the Modification of Sol Gel -- Spin Coating Approaches; Fabrication of Anodic Alumina Templates on Ti/Si Substrate and Preparation of Cu Nanorods by Electrochemical Process; P-Incorporated TiO2 Nanotube Arrays by Wet Impregnation Method for Efficient Photocatalytic Activity; Carbon Dioxide Capture at Various Temperatures Using Ca(OH)2 Sorbent Fabricated by Sol-Gel Route in Ethanol Media
505	8		\|a Fe-TiO2 Nanoparticles by Hydrothermal Treatment with Photocatalytic Activity EnhancementFormation of Platinum Nanodendrites Embedded Organic Insulator for Memory Application; Simulation and Fabrication of Silicon Field Emission Cathodes for Cold Electron Sources; Synthesis and Characterization of Zn-Al Layered Double Hydroxide (LDH) Nanocomposite Intercalated with Sodium Dodecyl Sulfate (SDS); The Effect of Zinc Oxide and Aluminum Oxide Nanoparticles on Interfacial Tension and Viscosity of Nanofluids for Enhanced Oil Recovery
505	8		\|a Effect of Metal Catalysts Type and Annealing Time on the Growth of Zinc Oxide Nanostructures by Thermal Vapor Deposition MethodEffect of Oxygen Flow Rate on the Memristive Behavior of Reactively Sputtered TiO2 Thin Films; Synthesis of CdSe Nanoparticles: Control of Reaction Temperature; The Effect of Hydrothermal Reaction Time on Formation of AuNPs by Sacrificial Templated Growth Hydrothermal Approach; Characterization of ITO/Ag and ITO/Ni Bi-Layer Transparent Conductive Electrodes; Fabrication of Gold Nanoparticles on Multiwalled Carbon Nanotubes Nanohybrids
505	8		\|a Microwave Synthesis of ZnO Nanoparticles for Enhanced Oil RecoverySynthesizing Vertically Aligned Zinc Oxide Nanowires on Borosilicate Glass Using Vapor Trapping Approach; Preparation of WO3 Nanorods by Seeded Growth Hydrothermal Reaction; Formation and Characterization of TiO2 Scattering Layer Deposited by Spray Pyrolysis for DSSC; Effect of Applied Voltage on the Formation of Self-Organized Iron Oxide Nanoporous Film in Organic Electrolyte via Anodic Oxidation Process and their Photocurrent Performance
520			\|a Collection of selected, peer reviewed papers from the 3rd International Conference on the Advancement of Materials and Nanotechnology 2013 (ICAMN III 2013), November 19-21, 2013, Penang. The 94 papers are grouped as follows: Chapter 1: Nanomaterial Research and Application, Chapter 2: Polymer Materials and Composites, Chapter 3: Functional and Structural Materials, Material Processing Technologies, Chapter 4: Micro/Nano Materials for Bio/Medical Application, Chapter 5: Materials and Technologies for Electric and Electronic Application Temporary description, more details to follow.
650		0	\|a Nanostructured materials \|v Congresses.
650		0	\|a Nanotechnology \|v Congresses.
650		0	\|a Materials \|v Congresses.
650		6	\|a Nanomatériaux \|v Congrès.
650		6	\|a Matériaux \|v Congrès.
650		6	\|a Nanotechnologie \|v Congrès.
650		7	\|a TECHNOLOGY & ENGINEERING \|x Engineering (General) \|2 bisacsh
650		7	\|a TECHNOLOGY & ENGINEERING \|x Reference. \|2 bisacsh
650		7	\|a Materials \|2 fast
650		7	\|a Nanostructured materials \|2 fast
650		7	\|a Nanotechnology \|2 fast
655		7	\|a Conference papers and proceedings \|2 fast
700	1		\|a Cheong, Kuan Yew.
776	0	8	\|i Erscheint auch als: \|n Druck-Ausgabe \|a International Conference on the Advancement of Materials and Nanotechnology 2013 (3rd . \|t 2013 : Penang). Advancement of materials and nanotechnology III : selected, peer reviewed papers from the 3 rd International Conference on the Advancement of Materials and Nanotechnology 2013 (ICAMN III 2013), November 19-21, 2013, Penang
830		0	\|a Advanced materials research ; \|v v. 1024. \|x 1022-6680 \|0 http://id.loc.gov/authorities/names/n99255722
856	4	0	\|l FWS01 \|p ZDB-4-EBA \|q FWS_PDA_EBA \|u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=842613 \|3 Volltext
938			\|a EBL - Ebook Library \|b EBLB \|n EBL1910911
938			\|a EBSCOhost \|b EBSC \|n 842613
938			\|a YBP Library Services \|b YANK \|n 12065289
994			\|a 92 \|b GEBAY
912			\|a ZDB-4-EBA
049			\|a DE-863

Datensatz im Suchindex

DE-BY-FWS_katkey	ZDB-4-EBA-ocn890407032
_version_	1816882286378876928
adam_text
any_adam_object
author2	Cheong, Kuan Yew
author2_role
author2_variant	k y c ky kyc
author_corporate	International Conference on the Advancement of Materials and Nanotechnology Penang
author_corporate_role
author_facet	Cheong, Kuan Yew International Conference on the Advancement of Materials and Nanotechnology Penang
author_sort	International Conference on the Advancement of Materials and Nanotechnology Penang
building	Verbundindex
bvnumber	localFWS
callnumber-first	T - Technology
callnumber-label	TA418
callnumber-raw	TA418.9.N35
callnumber-search	TA418.9.N35
callnumber-sort	TA 3418.9 N35
callnumber-subject	TA - General and Civil Engineering
collection	ZDB-4-EBA
contents	Advancement of Materials and Nanotechnology III; Preface and Committees; Table of Contents; Chapter 1: Nanomaterial Research and Application; Design and Synthesis Silica-Polyelectrolyte-Iron Oxide Nanocomposite with Magnetic-Catalytic Bifunctionalities for Dye Removal; Effect of Calcination Temperature on the Morphological and Phase Structure of Hydrothermally Synthesized Copper Ion Doped TiO2 Nanotubes; Nanoclay for Micropollutant Removal in Wastewater-Effective Alternative?; S-Parameters of Bismuth Iron Garnet (BIG) Filled Polyvinylidene Fluoride Composite Using Rectangular Waveguide Method Controlled Growth of ZnO Nanoparticles with Different Morphologies Using Sol-Gel TechniqueImproving the Production of Self-Assembled ZnS:Mn Nanocrystals through the Modification of Sol Gel -- Spin Coating Approaches; Fabrication of Anodic Alumina Templates on Ti/Si Substrate and Preparation of Cu Nanorods by Electrochemical Process; P-Incorporated TiO2 Nanotube Arrays by Wet Impregnation Method for Efficient Photocatalytic Activity; Carbon Dioxide Capture at Various Temperatures Using Ca(OH)2 Sorbent Fabricated by Sol-Gel Route in Ethanol Media Fe-TiO2 Nanoparticles by Hydrothermal Treatment with Photocatalytic Activity EnhancementFormation of Platinum Nanodendrites Embedded Organic Insulator for Memory Application; Simulation and Fabrication of Silicon Field Emission Cathodes for Cold Electron Sources; Synthesis and Characterization of Zn-Al Layered Double Hydroxide (LDH) Nanocomposite Intercalated with Sodium Dodecyl Sulfate (SDS); The Effect of Zinc Oxide and Aluminum Oxide Nanoparticles on Interfacial Tension and Viscosity of Nanofluids for Enhanced Oil Recovery Effect of Metal Catalysts Type and Annealing Time on the Growth of Zinc Oxide Nanostructures by Thermal Vapor Deposition MethodEffect of Oxygen Flow Rate on the Memristive Behavior of Reactively Sputtered TiO2 Thin Films; Synthesis of CdSe Nanoparticles: Control of Reaction Temperature; The Effect of Hydrothermal Reaction Time on Formation of AuNPs by Sacrificial Templated Growth Hydrothermal Approach; Characterization of ITO/Ag and ITO/Ni Bi-Layer Transparent Conductive Electrodes; Fabrication of Gold Nanoparticles on Multiwalled Carbon Nanotubes Nanohybrids Microwave Synthesis of ZnO Nanoparticles for Enhanced Oil RecoverySynthesizing Vertically Aligned Zinc Oxide Nanowires on Borosilicate Glass Using Vapor Trapping Approach; Preparation of WO3 Nanorods by Seeded Growth Hydrothermal Reaction; Formation and Characterization of TiO2 Scattering Layer Deposited by Spray Pyrolysis for DSSC; Effect of Applied Voltage on the Formation of Self-Organized Iron Oxide Nanoporous Film in Organic Electrolyte via Anodic Oxidation Process and their Photocurrent Performance
ctrlnum	(OCoLC)890407032
dewey-full	620.1/15
dewey-hundreds	600 - Technology (Applied sciences)
dewey-ones	620 - Engineering and allied operations
dewey-raw	620.1/15
dewey-search	620.1/15
dewey-sort	3620.1 215
dewey-tens	620 - Engineering and allied operations
format	Electronic Conference Proceeding eBook
fullrecord	<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>06367cam a2200649 i 4500</leader><controlfield tag="001">ZDB-4-EBA-ocn890407032</controlfield><controlfield tag="003">OCoLC</controlfield><controlfield tag="005">20241004212047.0</controlfield><controlfield tag="006">m o d </controlfield><controlfield tag="007">cr cnu---unuuu</controlfield><controlfield tag="008">140911s2014 sz ob 101 0 eng d</controlfield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">N$T</subfield><subfield code="b">eng</subfield><subfield code="e">rda</subfield><subfield code="e">pn</subfield><subfield code="c">N$T</subfield><subfield code="d">EBLCP</subfield><subfield code="d">YDXCP</subfield><subfield code="d">OCLCF</subfield><subfield code="d">DEBSZ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCL</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCL</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">DEBBG</subfield><subfield code="d">AGLDB</subfield><subfield code="d">ZCU</subfield><subfield code="d">MERUC</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">VTS</subfield><subfield code="d">ICG</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">STF</subfield><subfield code="d">DKC</subfield><subfield code="d">AU@</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">M8D</subfield><subfield code="d">OCL</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">AJS</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">SGP</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038265962</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3038265969</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)890407032</subfield></datafield><datafield tag="050" ind1=" " ind2="4"><subfield code="a">TA418.9.N35</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">TEC</subfield><subfield code="x">021000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">TEC</subfield><subfield code="x">009000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">TEC</subfield><subfield code="x">035000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="082" ind1="7" ind2=" "><subfield code="a">620.1/15</subfield><subfield code="2">23</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">MAIN</subfield></datafield><datafield tag="111" ind1="2" ind2=" "><subfield code="a">International Conference on the Advancement of Materials and Nanotechnology</subfield><subfield code="n">(3rd :</subfield><subfield code="d">2013 :</subfield><subfield code="c">Penang)</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Advancement of materials and nanotechnology II :</subfield><subfield code="b">selected, peer reviewed papers from the International Conference on the Advancement of Materials and Nanotechnology (ICAMN III 2013), November 19-21,2013, Kuala Lumpur, Malaysia /</subfield><subfield code="c">edited by Kuan Yew Cheong andn [five others].</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Pfaffikon :</subfield><subfield code="b">Trans Tech Publications,</subfield><subfield code="c">[2014]</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">©2014</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">computer</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">online resource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Advanced materials research,</subfield><subfield code="x">1022-6680 ;</subfield><subfield code="v">v. 1024</subfield></datafield><datafield tag="504" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references and index.</subfield></datafield><datafield tag="505" ind1="0" ind2=" "><subfield code="a">Advancement of Materials and Nanotechnology III; Preface and Committees; Table of Contents; Chapter 1: Nanomaterial Research and Application; Design and Synthesis Silica-Polyelectrolyte-Iron Oxide Nanocomposite with Magnetic-Catalytic Bifunctionalities for Dye Removal; Effect of Calcination Temperature on the Morphological and Phase Structure of Hydrothermally Synthesized Copper Ion Doped TiO2 Nanotubes; Nanoclay for Micropollutant Removal in Wastewater-Effective Alternative?; S-Parameters of Bismuth Iron Garnet (BIG) Filled Polyvinylidene Fluoride Composite Using Rectangular Waveguide Method</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Controlled Growth of ZnO Nanoparticles with Different Morphologies Using Sol-Gel TechniqueImproving the Production of Self-Assembled ZnS:Mn Nanocrystals through the Modification of Sol Gel -- Spin Coating Approaches; Fabrication of Anodic Alumina Templates on Ti/Si Substrate and Preparation of Cu Nanorods by Electrochemical Process; P-Incorporated TiO2 Nanotube Arrays by Wet Impregnation Method for Efficient Photocatalytic Activity; Carbon Dioxide Capture at Various Temperatures Using Ca(OH)2 Sorbent Fabricated by Sol-Gel Route in Ethanol Media</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Fe-TiO2 Nanoparticles by Hydrothermal Treatment with Photocatalytic Activity EnhancementFormation of Platinum Nanodendrites Embedded Organic Insulator for Memory Application; Simulation and Fabrication of Silicon Field Emission Cathodes for Cold Electron Sources; Synthesis and Characterization of Zn-Al Layered Double Hydroxide (LDH) Nanocomposite Intercalated with Sodium Dodecyl Sulfate (SDS); The Effect of Zinc Oxide and Aluminum Oxide Nanoparticles on Interfacial Tension and Viscosity of Nanofluids for Enhanced Oil Recovery</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Effect of Metal Catalysts Type and Annealing Time on the Growth of Zinc Oxide Nanostructures by Thermal Vapor Deposition MethodEffect of Oxygen Flow Rate on the Memristive Behavior of Reactively Sputtered TiO2 Thin Films; Synthesis of CdSe Nanoparticles: Control of Reaction Temperature; The Effect of Hydrothermal Reaction Time on Formation of AuNPs by Sacrificial Templated Growth Hydrothermal Approach; Characterization of ITO/Ag and ITO/Ni Bi-Layer Transparent Conductive Electrodes; Fabrication of Gold Nanoparticles on Multiwalled Carbon Nanotubes Nanohybrids</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Microwave Synthesis of ZnO Nanoparticles for Enhanced Oil RecoverySynthesizing Vertically Aligned Zinc Oxide Nanowires on Borosilicate Glass Using Vapor Trapping Approach; Preparation of WO3 Nanorods by Seeded Growth Hydrothermal Reaction; Formation and Characterization of TiO2 Scattering Layer Deposited by Spray Pyrolysis for DSSC; Effect of Applied Voltage on the Formation of Self-Organized Iron Oxide Nanoporous Film in Organic Electrolyte via Anodic Oxidation Process and their Photocurrent Performance</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Collection of selected, peer reviewed papers from the 3rd International Conference on the Advancement of Materials and Nanotechnology 2013 (ICAMN III 2013), November 19-21, 2013, Penang. The 94 papers are grouped as follows: Chapter 1: Nanomaterial Research and Application, Chapter 2: Polymer Materials and Composites, Chapter 3: Functional and Structural Materials, Material Processing Technologies, Chapter 4: Micro/Nano Materials for Bio/Medical Application, Chapter 5: Materials and Technologies for Electric and Electronic Application Temporary description, more details to follow.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Nanostructured materials</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Nanotechnology</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Materials</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Nanomatériaux</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Matériaux</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Nanotechnologie</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING</subfield><subfield code="x">Engineering (General)</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING</subfield><subfield code="x">Reference.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Materials</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Nanostructured materials</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Nanotechnology</subfield><subfield code="2">fast</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">Conference papers and proceedings</subfield><subfield code="2">fast</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Cheong, Kuan Yew.</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als:</subfield><subfield code="n">Druck-Ausgabe</subfield><subfield code="a">International Conference on the Advancement of Materials and Nanotechnology 2013 (3rd .</subfield><subfield code="t">2013 : Penang). Advancement of materials and nanotechnology III : selected, peer reviewed papers from the 3 rd International Conference on the Advancement of Materials and Nanotechnology 2013 (ICAMN III 2013), November 19-21, 2013, Penang</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Advanced materials research ;</subfield><subfield code="v">v. 1024.</subfield><subfield code="x">1022-6680</subfield><subfield code="0">http://id.loc.gov/authorities/names/n99255722</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="l">FWS01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=842613</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">EBL - Ebook Library</subfield><subfield code="b">EBLB</subfield><subfield code="n">EBL1910911</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">EBSCOhost</subfield><subfield code="b">EBSC</subfield><subfield code="n">842613</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">YBP Library Services</subfield><subfield code="b">YANK</subfield><subfield code="n">12065289</subfield></datafield><datafield tag="994" ind1=" " ind2=" "><subfield code="a">92</subfield><subfield code="b">GEBAY</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-863</subfield></datafield></record></collection>
genre	Conference papers and proceedings fast
genre_facet	Conference papers and proceedings
id	ZDB-4-EBA-ocn890407032
illustrated	Not Illustrated
indexdate	2024-11-27T13:26:12Z
institution	BVB
isbn	9783038265962 3038265969
issn	1022-6680 ;
language	English
oclc_num	890407032
open_access_boolean
owner	MAIN DE-863 DE-BY-FWS
owner_facet	MAIN DE-863 DE-BY-FWS
physical	1 online resource
psigel	ZDB-4-EBA
publishDate	2014
publishDateSearch	2014
publishDateSort	2014
publisher	Trans Tech Publications,
record_format	marc
series	Advanced materials research ;
series2	Advanced materials research,
spelling	International Conference on the Advancement of Materials and Nanotechnology (3rd : 2013 : Penang) Advancement of materials and nanotechnology II : selected, peer reviewed papers from the International Conference on the Advancement of Materials and Nanotechnology (ICAMN III 2013), November 19-21,2013, Kuala Lumpur, Malaysia / edited by Kuan Yew Cheong andn [five others]. Pfaffikon : Trans Tech Publications, [2014] ©2014 1 online resource text txt rdacontent computer c rdamedia online resource cr rdacarrier Advanced materials research, 1022-6680 ; v. 1024 Includes bibliographical references and index. Advancement of Materials and Nanotechnology III; Preface and Committees; Table of Contents; Chapter 1: Nanomaterial Research and Application; Design and Synthesis Silica-Polyelectrolyte-Iron Oxide Nanocomposite with Magnetic-Catalytic Bifunctionalities for Dye Removal; Effect of Calcination Temperature on the Morphological and Phase Structure of Hydrothermally Synthesized Copper Ion Doped TiO2 Nanotubes; Nanoclay for Micropollutant Removal in Wastewater-Effective Alternative?; S-Parameters of Bismuth Iron Garnet (BIG) Filled Polyvinylidene Fluoride Composite Using Rectangular Waveguide Method Controlled Growth of ZnO Nanoparticles with Different Morphologies Using Sol-Gel TechniqueImproving the Production of Self-Assembled ZnS:Mn Nanocrystals through the Modification of Sol Gel -- Spin Coating Approaches; Fabrication of Anodic Alumina Templates on Ti/Si Substrate and Preparation of Cu Nanorods by Electrochemical Process; P-Incorporated TiO2 Nanotube Arrays by Wet Impregnation Method for Efficient Photocatalytic Activity; Carbon Dioxide Capture at Various Temperatures Using Ca(OH)2 Sorbent Fabricated by Sol-Gel Route in Ethanol Media Fe-TiO2 Nanoparticles by Hydrothermal Treatment with Photocatalytic Activity EnhancementFormation of Platinum Nanodendrites Embedded Organic Insulator for Memory Application; Simulation and Fabrication of Silicon Field Emission Cathodes for Cold Electron Sources; Synthesis and Characterization of Zn-Al Layered Double Hydroxide (LDH) Nanocomposite Intercalated with Sodium Dodecyl Sulfate (SDS); The Effect of Zinc Oxide and Aluminum Oxide Nanoparticles on Interfacial Tension and Viscosity of Nanofluids for Enhanced Oil Recovery Effect of Metal Catalysts Type and Annealing Time on the Growth of Zinc Oxide Nanostructures by Thermal Vapor Deposition MethodEffect of Oxygen Flow Rate on the Memristive Behavior of Reactively Sputtered TiO2 Thin Films; Synthesis of CdSe Nanoparticles: Control of Reaction Temperature; The Effect of Hydrothermal Reaction Time on Formation of AuNPs by Sacrificial Templated Growth Hydrothermal Approach; Characterization of ITO/Ag and ITO/Ni Bi-Layer Transparent Conductive Electrodes; Fabrication of Gold Nanoparticles on Multiwalled Carbon Nanotubes Nanohybrids Microwave Synthesis of ZnO Nanoparticles for Enhanced Oil RecoverySynthesizing Vertically Aligned Zinc Oxide Nanowires on Borosilicate Glass Using Vapor Trapping Approach; Preparation of WO3 Nanorods by Seeded Growth Hydrothermal Reaction; Formation and Characterization of TiO2 Scattering Layer Deposited by Spray Pyrolysis for DSSC; Effect of Applied Voltage on the Formation of Self-Organized Iron Oxide Nanoporous Film in Organic Electrolyte via Anodic Oxidation Process and their Photocurrent Performance Collection of selected, peer reviewed papers from the 3rd International Conference on the Advancement of Materials and Nanotechnology 2013 (ICAMN III 2013), November 19-21, 2013, Penang. The 94 papers are grouped as follows: Chapter 1: Nanomaterial Research and Application, Chapter 2: Polymer Materials and Composites, Chapter 3: Functional and Structural Materials, Material Processing Technologies, Chapter 4: Micro/Nano Materials for Bio/Medical Application, Chapter 5: Materials and Technologies for Electric and Electronic Application Temporary description, more details to follow. Nanostructured materials Congresses. Nanotechnology Congresses. Materials Congresses. Nanomatériaux Congrès. Matériaux Congrès. Nanotechnologie Congrès. TECHNOLOGY & ENGINEERING Engineering (General) bisacsh TECHNOLOGY & ENGINEERING Reference. bisacsh Materials fast Nanostructured materials fast Nanotechnology fast Conference papers and proceedings fast Cheong, Kuan Yew. Erscheint auch als: Druck-Ausgabe International Conference on the Advancement of Materials and Nanotechnology 2013 (3rd . 2013 : Penang). Advancement of materials and nanotechnology III : selected, peer reviewed papers from the 3 rd International Conference on the Advancement of Materials and Nanotechnology 2013 (ICAMN III 2013), November 19-21, 2013, Penang Advanced materials research ; v. 1024. 1022-6680 http://id.loc.gov/authorities/names/n99255722 FWS01 ZDB-4-EBA FWS_PDA_EBA https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=842613 Volltext
spellingShingle	Advancement of materials and nanotechnology II : selected, peer reviewed papers from the International Conference on the Advancement of Materials and Nanotechnology (ICAMN III 2013), November 19-21,2013, Kuala Lumpur, Malaysia / Advanced materials research ; Advancement of Materials and Nanotechnology III; Preface and Committees; Table of Contents; Chapter 1: Nanomaterial Research and Application; Design and Synthesis Silica-Polyelectrolyte-Iron Oxide Nanocomposite with Magnetic-Catalytic Bifunctionalities for Dye Removal; Effect of Calcination Temperature on the Morphological and Phase Structure of Hydrothermally Synthesized Copper Ion Doped TiO2 Nanotubes; Nanoclay for Micropollutant Removal in Wastewater-Effective Alternative?; S-Parameters of Bismuth Iron Garnet (BIG) Filled Polyvinylidene Fluoride Composite Using Rectangular Waveguide Method Controlled Growth of ZnO Nanoparticles with Different Morphologies Using Sol-Gel TechniqueImproving the Production of Self-Assembled ZnS:Mn Nanocrystals through the Modification of Sol Gel -- Spin Coating Approaches; Fabrication of Anodic Alumina Templates on Ti/Si Substrate and Preparation of Cu Nanorods by Electrochemical Process; P-Incorporated TiO2 Nanotube Arrays by Wet Impregnation Method for Efficient Photocatalytic Activity; Carbon Dioxide Capture at Various Temperatures Using Ca(OH)2 Sorbent Fabricated by Sol-Gel Route in Ethanol Media Fe-TiO2 Nanoparticles by Hydrothermal Treatment with Photocatalytic Activity EnhancementFormation of Platinum Nanodendrites Embedded Organic Insulator for Memory Application; Simulation and Fabrication of Silicon Field Emission Cathodes for Cold Electron Sources; Synthesis and Characterization of Zn-Al Layered Double Hydroxide (LDH) Nanocomposite Intercalated with Sodium Dodecyl Sulfate (SDS); The Effect of Zinc Oxide and Aluminum Oxide Nanoparticles on Interfacial Tension and Viscosity of Nanofluids for Enhanced Oil Recovery Effect of Metal Catalysts Type and Annealing Time on the Growth of Zinc Oxide Nanostructures by Thermal Vapor Deposition MethodEffect of Oxygen Flow Rate on the Memristive Behavior of Reactively Sputtered TiO2 Thin Films; Synthesis of CdSe Nanoparticles: Control of Reaction Temperature; The Effect of Hydrothermal Reaction Time on Formation of AuNPs by Sacrificial Templated Growth Hydrothermal Approach; Characterization of ITO/Ag and ITO/Ni Bi-Layer Transparent Conductive Electrodes; Fabrication of Gold Nanoparticles on Multiwalled Carbon Nanotubes Nanohybrids Microwave Synthesis of ZnO Nanoparticles for Enhanced Oil RecoverySynthesizing Vertically Aligned Zinc Oxide Nanowires on Borosilicate Glass Using Vapor Trapping Approach; Preparation of WO3 Nanorods by Seeded Growth Hydrothermal Reaction; Formation and Characterization of TiO2 Scattering Layer Deposited by Spray Pyrolysis for DSSC; Effect of Applied Voltage on the Formation of Self-Organized Iron Oxide Nanoporous Film in Organic Electrolyte via Anodic Oxidation Process and their Photocurrent Performance Nanostructured materials Congresses. Nanotechnology Congresses. Materials Congresses. Nanomatériaux Congrès. Matériaux Congrès. Nanotechnologie Congrès. TECHNOLOGY & ENGINEERING Engineering (General) bisacsh TECHNOLOGY & ENGINEERING Reference. bisacsh Materials fast Nanostructured materials fast Nanotechnology fast
title	Advancement of materials and nanotechnology II : selected, peer reviewed papers from the International Conference on the Advancement of Materials and Nanotechnology (ICAMN III 2013), November 19-21,2013, Kuala Lumpur, Malaysia /
title_auth	Advancement of materials and nanotechnology II : selected, peer reviewed papers from the International Conference on the Advancement of Materials and Nanotechnology (ICAMN III 2013), November 19-21,2013, Kuala Lumpur, Malaysia /
title_exact_search	Advancement of materials and nanotechnology II : selected, peer reviewed papers from the International Conference on the Advancement of Materials and Nanotechnology (ICAMN III 2013), November 19-21,2013, Kuala Lumpur, Malaysia /
title_full	Advancement of materials and nanotechnology II : selected, peer reviewed papers from the International Conference on the Advancement of Materials and Nanotechnology (ICAMN III 2013), November 19-21,2013, Kuala Lumpur, Malaysia / edited by Kuan Yew Cheong andn [five others].
title_fullStr	Advancement of materials and nanotechnology II : selected, peer reviewed papers from the International Conference on the Advancement of Materials and Nanotechnology (ICAMN III 2013), November 19-21,2013, Kuala Lumpur, Malaysia / edited by Kuan Yew Cheong andn [five others].
title_full_unstemmed	Advancement of materials and nanotechnology II : selected, peer reviewed papers from the International Conference on the Advancement of Materials and Nanotechnology (ICAMN III 2013), November 19-21,2013, Kuala Lumpur, Malaysia / edited by Kuan Yew Cheong andn [five others].
title_short	Advancement of materials and nanotechnology II :
title_sort	advancement of materials and nanotechnology ii selected peer reviewed papers from the international conference on the advancement of materials and nanotechnology icamn iii 2013 november 19 21 2013 kuala lumpur malaysia
title_sub	selected, peer reviewed papers from the International Conference on the Advancement of Materials and Nanotechnology (ICAMN III 2013), November 19-21,2013, Kuala Lumpur, Malaysia /
topic	Nanostructured materials Congresses. Nanotechnology Congresses. Materials Congresses. Nanomatériaux Congrès. Matériaux Congrès. Nanotechnologie Congrès. TECHNOLOGY & ENGINEERING Engineering (General) bisacsh TECHNOLOGY & ENGINEERING Reference. bisacsh Materials fast Nanostructured materials fast Nanotechnology fast
topic_facet	Nanostructured materials Congresses. Nanotechnology Congresses. Materials Congresses. Nanomatériaux Congrès. Matériaux Congrès. Nanotechnologie Congrès. TECHNOLOGY & ENGINEERING Engineering (General) TECHNOLOGY & ENGINEERING Reference. Materials Nanostructured materials Nanotechnology Conference papers and proceedings
url	https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=842613
work_keys_str_mv	AT internationalconferenceontheadvancementofmaterialsandnanotechnologypenang advancementofmaterialsandnanotechnologyiiselectedpeerreviewedpapersfromtheinternationalconferenceontheadvancementofmaterialsandnanotechnologyicamniii2013november19212013kualalumpurmalaysia AT cheongkuanyew advancementofmaterialsandnanotechnologyiiselectedpeerreviewedpapersfromtheinternationalconferenceontheadvancementofmaterialsandnanotechnologyicamniii2013november19212013kualalumpurmalaysia

Verfügbarkeit

MARC

Datensatz im Suchindex

Ähnliche Einträge