Computer and information technology :: selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China /
Collection of selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China. The 335 papers are grouped as follows: Chapter 1: Databases, Data Processing and Data Management, Chapter 2: Parallel and Distributed...
Gespeichert in:
| Körperschaft: | |
|---|---|
| Weitere Verfasser: | , , |
| Format: | Elektronisch Tagungsbericht E-Book |
| Sprache: | English |
| Veröffentlicht: |
[Zurich], Switzerland :
Trans Tech Publications,
[2014]
|
| Schriftenreihe: | Applied mechanics and materials ;
v. 519-520. |
| Schlagworte: | |
| Online-Zugang: | Volltext |
| Zusammenfassung: | Collection of selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China. The 335 papers are grouped as follows: Chapter 1: Databases, Data Processing and Data Management, Chapter 2: Parallel and Distributed Computing, Chapter 3: Computer Network Technology and Applications, Chapter 4: Software Engineering, Chapter 5: E-Commerce and E-Government, Chapter 6: Multimedia Technology and Application, Chapter 7: Computer Vision and Image Processing Technology, Chapter 8: Artificial Intelligence, Intelligent Algorithms and Computational Mathematics, Chapter 9: Computer Aided Design and Research, Chapter 10: Communications Technology and Signal Processing, Chapter 11: Electronic Devices and Embedded Systems, Chapter 12: Intelligent Instruments, Techniques for Detection and Testing, Sensors and Measurement, Chapter 13: Automation and Control, Chapter 14: Information Technologies in Engineering Management, Chapter 15: Enterprise Resource Planning and Management System, Chapter 16: Information Technologies in Education Keyword: Databases, Data Processing and Data Management, Parallel and Distributed Computing, Computer Network Technology and Applications, Software Engineering, E-Commerce and E-Government, Multimedia Technology and Application, Computer Vision and Image Processing Technology, Artificial Intelligence, Intelligent Algorithms and Computational Mathematics, Computer Aided Design and Research, Communications Technology and Signal Processing, Electronic Devices and Embedded Systems, Intelligent Instruments, Techniques for Detection and Testing, Sensors and Measurement, Automation and Control, Information Technologies in Engineering Management, Enterprise Resource Planning and Management System, Information Technologies in Education. |
| Beschreibung: | 1 online resource (1711 pages) : illustrations (some color), graphs, photographs |
| Bibliographie: | Includes bibliographical references at the end of each chapters and indexes. |
| ISBN: | 9783038264002 3038264008 |
| ISSN: | 1662-7482 ; 1662-7482 |
Internformat
MARC
| LEADER | 00000cam a2200000 i 4500 | ||
|---|---|---|---|
| 001 | ZDB-4-EBA-ocn878138238 | ||
| 003 | OCoLC | ||
| 005 | 20240705115654.0 | ||
| 006 | m o d | ||
| 007 | cr cn||||||||| | ||
| 008 | 140321t20142014sz ao ob 101 0 eng d | ||
| 040 | |a E7B |b eng |e rda |e pn |c E7B |d CUS |d OCLCO |d N$T |d OCLCO |d OCLCF |d EBLCP |d YDXCP |d DEBSZ |d OCLCO |d OCLCQ |d OCLCO |d LLB |d OCL |d OCLCO |d AZK |d OCLCO |d AGLDB |d OCLCQ |d VTS |d STF |d OCLCQ |d TTECH |d VLY |d AJS |d OCLCO |d OCLCQ |d OCLCO | ||
| 019 | |a 890755139 |a 927292833 |a 961494529 | ||
| 020 | |a 9783038264002 |q (electronic bk.) | ||
| 020 | |a 3038264008 |q (electronic bk.) | ||
| 020 | |z 9783038350194 | ||
| 035 | |a (OCoLC)878138238 |z (OCoLC)890755139 |z (OCoLC)927292833 |z (OCoLC)961494529 | ||
| 050 | 4 | |a QA75.5 |b .C667 2014eb | |
| 072 | 7 | |a COM |x 013000 |2 bisacsh | |
| 072 | 7 | |a COM |x 014000 |2 bisacsh | |
| 072 | 7 | |a COM |x 018000 |2 bisacsh | |
| 072 | 7 | |a COM |x 067000 |2 bisacsh | |
| 072 | 7 | |a COM |x 032000 |2 bisacsh | |
| 072 | 7 | |a COM |x 037000 |2 bisacsh | |
| 072 | 7 | |a COM |x 052000 |2 bisacsh | |
| 082 | 7 | |a 004 |2 23 | |
| 049 | |a MAIN | ||
| 111 | 2 | |a International Forum on Computer and Information Technology |d (2013 : |c Shenzhen, China) | |
| 245 | 1 | 0 | |a Computer and information technology : |b selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China / |c edited by Prasad Yarlagadda, Seung-Bok Choi and Yun-Hae Kim. |
| 264 | 1 | |a [Zurich], Switzerland : |b Trans Tech Publications, |c [2014] | |
| 264 | 4 | |c ©2014 | |
| 300 | |a 1 online resource (1711 pages) : |b illustrations (some color), graphs, photographs | ||
| 336 | |a text |b txt |2 rdacontent | ||
| 337 | |a computer |b c |2 rdamedia | ||
| 338 | |a online resource |b cr |2 rdacarrier | ||
| 490 | 1 | |a Applied Mechanics and Materials, |x 1662-7482 ; |v Volume 519-520 | |
| 504 | |a Includes bibliographical references at the end of each chapters and indexes. | ||
| 588 | 0 | |a Online resource; title from PDF title page (ebrary, viewed March 20, 2014). | |
| 520 | |a Collection of selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China. The 335 papers are grouped as follows: Chapter 1: Databases, Data Processing and Data Management, Chapter 2: Parallel and Distributed Computing, Chapter 3: Computer Network Technology and Applications, Chapter 4: Software Engineering, Chapter 5: E-Commerce and E-Government, Chapter 6: Multimedia Technology and Application, Chapter 7: Computer Vision and Image Processing Technology, Chapter 8: Artificial Intelligence, Intelligent Algorithms and Computational Mathematics, Chapter 9: Computer Aided Design and Research, Chapter 10: Communications Technology and Signal Processing, Chapter 11: Electronic Devices and Embedded Systems, Chapter 12: Intelligent Instruments, Techniques for Detection and Testing, Sensors and Measurement, Chapter 13: Automation and Control, Chapter 14: Information Technologies in Engineering Management, Chapter 15: Enterprise Resource Planning and Management System, Chapter 16: Information Technologies in Education Keyword: Databases, Data Processing and Data Management, Parallel and Distributed Computing, Computer Network Technology and Applications, Software Engineering, E-Commerce and E-Government, Multimedia Technology and Application, Computer Vision and Image Processing Technology, Artificial Intelligence, Intelligent Algorithms and Computational Mathematics, Computer Aided Design and Research, Communications Technology and Signal Processing, Electronic Devices and Embedded Systems, Intelligent Instruments, Techniques for Detection and Testing, Sensors and Measurement, Automation and Control, Information Technologies in Engineering Management, Enterprise Resource Planning and Management System, Information Technologies in Education. | ||
| 505 | 0 | |a Computer and Information Technology; Preface and Conference Organization; Table of Contents; Chapter 1: Databases, Data Processing and Data Management; A Framework for Processing Water Resources Big Data and Application; Accurate Location in Batch Dynamic Provable Data Possession; Construction of Data Warehouse Platform in Continual Quality Improvement; Research on Technology of CRM Stored Procedure; Research on the Integration Technology of Marine Environmental Protection Data; Research on SQL Performance Optimization of CRM Stored Procedure | |
| 505 | 8 | |a Design of E-Archives Portfolio System Based on Signature TechnologyMLTwig: A Multi-Layer Tree Pattern Matching Approach for XQuery; Research and Implementation on Compression, Encryption, Storage and Retrieval System for Massive Data; The Research of Distributed Bitmap Index; Analysis of Distributed Computing Architecture Search Principle Based on Hadoop; Study of Network Public Opinion Classification Method Based on Naive Bayesian Algorithm in Hadoop Environment; Study on Object-Storage System Metadata Load Balancing; Research on PPHIIS Based on Ontology Model | |
| 505 | 8 | |a Online Data Compression Technique for Real Time Data of Energy Management System in the Industrial ProductionChapter 2: Parallel and Distributed Computing; Time Synchronization Method for Parallel Traffic Simulation Framework; Comparison of Parallel Computing Methods for Fast Cone-Beam Reconstruction with Similar Optimization Strategies; Research on Parallel Yen Algorithms on GPUs Using CUDA; Parallelization Analysis of Dissolved Gases in Transformer Oil Based on Random Forest Algorithm; GPU Accelerated Reconstruction in Compton Scattering Tomography Using Matrix Compression | |
| 505 | 8 | |a Parallel Scheduling Algorithms Investigation of Support Strict Resource Reservation from GridChapter 3: Computer Network Technology and Applications; A Dynamic Back-Off Algorithm in Ad Hoc Networks; A Fast Real-Time Scheduling Algorithm for WIA-PA; Research on Network Security Issues and Security Model; The Web Foreign Language Teaching Research Based on P2P Technology; A Multi-Redundancy Structure Model of Cloud Computing Digital Library; A Novel Mobility Management Scheme for Hierarchical MIPv6 Network; A Novel Response Time-Driven Replica Selection Approach for Cloud Computing | |
| 505 | 8 | |a A Secure Mobile Payments Protocol Based on ECCA Security Routing Protocol Based on Convergence Degree and Trust; A Trust System Design for Future SCADA Network Security; The Micro-Blogging Network Leading Group Recognition Algorithm; The Design and Implementation of an Optimized MPTCP Data Scheduling Algorithm; The Design of PMP-AODV Routing Protocol in Wireless Mesh Network; An Attribute Mapping Technique for Secure Interoperation in Multi-Domain Environments; An Authentication Scheme Based on the Light-Weight Rainbow Signature for Wireless Sensor Network | |
| 650 | 0 | |a Computer science |v Congresses. | |
| 650 | 0 | |a Information technology |v Congresses. | |
| 650 | 6 | |a Informatique |v Congrès. | |
| 650 | 6 | |a Technologie de l'information |v Congrès. | |
| 650 | 7 | |a COMPUTERS |x Computer Literacy. |2 bisacsh | |
| 650 | 7 | |a COMPUTERS |x Computer Science. |2 bisacsh | |
| 650 | 7 | |a COMPUTERS |x Data Processing. |2 bisacsh | |
| 650 | 7 | |a COMPUTERS |x Hardware |x General. |2 bisacsh | |
| 650 | 7 | |a COMPUTERS |x Information Technology. |2 bisacsh | |
| 650 | 7 | |a COMPUTERS |x Machine Theory. |2 bisacsh | |
| 650 | 7 | |a COMPUTERS |x Reference. |2 bisacsh | |
| 650 | 7 | |a Computer science |2 fast | |
| 650 | 7 | |a Information technology |2 fast | |
| 655 | 7 | |a Conference papers and proceedings |2 fast | |
| 700 | 1 | |a Yarlagadda, Prasad K. D. V., |e editor. |0 http://id.loc.gov/authorities/names/no2012045174 | |
| 700 | 1 | |a Choi, Seung-Bok, |e editor. | |
| 700 | 1 | |a Kim, Yun-Hae, |e editor. | |
| 776 | 0 | 8 | |i Print version: |t Computer and information technology : selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China. |d Zurich, Switzerland : TTP, ©2014 |h 1713 pages |k Applied mechanics and materials ; Volume 519-520 |x 1662-7482 |z 9783038350194 |
| 830 | 0 | |a Applied mechanics and materials ; |v v. 519-520. |0 http://id.loc.gov/authorities/names/no2009039852 | |
| 856 | 1 | |l FWS01 |p ZDB-4-EBA |q FWS_PDA_EBA |u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711963 |3 Volltext | |
| 856 | 1 | |l CBO01 |p ZDB-4-EBA |q FWS_PDA_EBA |u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711963 |3 Volltext | |
| 938 | |a ProQuest Ebook Central |b EBLB |n EBL1910716 | ||
| 938 | |a ebrary |b EBRY |n ebr10846239 | ||
| 938 | |a EBSCOhost |b EBSC |n 711963 | ||
| 938 | |a Trans Tech Publications, Ltd |b TRAN |n 10.4028/www.scientific.net/AMM.519-520 | ||
| 938 | |a YBP Library Services |b YANK |n 11697652 | ||
| 994 | |a 92 |b GEBAY | ||
| 912 | |a ZDB-4-EBA | ||
Datensatz im Suchindex
| DE-BY-FWS_katkey | ZDB-4-EBA-ocn878138238 |
|---|---|
| _version_ | 1813903644633858048 |
| adam_text | |
| any_adam_object | |
| author2 | Yarlagadda, Prasad K. D. V. Choi, Seung-Bok Kim, Yun-Hae |
| author2_role | edt edt edt |
| author2_variant | p k d v y pkdv pkdvy s b c sbc y h k yhk |
| author_GND | http://id.loc.gov/authorities/names/no2012045174 |
| author_corporate | International Forum on Computer and Information Technology Shenzhen, China |
| author_corporate_role | |
| author_facet | Yarlagadda, Prasad K. D. V. Choi, Seung-Bok Kim, Yun-Hae International Forum on Computer and Information Technology Shenzhen, China |
| author_sort | International Forum on Computer and Information Technology Shenzhen, China |
| building | Verbundindex |
| bvnumber | localFWS |
| callnumber-first | Q - Science |
| callnumber-label | QA75 |
| callnumber-raw | QA75.5 .C667 2014eb |
| callnumber-search | QA75.5 .C667 2014eb |
| callnumber-sort | QA 275.5 C667 42014EB |
| callnumber-subject | QA - Mathematics |
| collection | ZDB-4-EBA |
| contents | Computer and Information Technology; Preface and Conference Organization; Table of Contents; Chapter 1: Databases, Data Processing and Data Management; A Framework for Processing Water Resources Big Data and Application; Accurate Location in Batch Dynamic Provable Data Possession; Construction of Data Warehouse Platform in Continual Quality Improvement; Research on Technology of CRM Stored Procedure; Research on the Integration Technology of Marine Environmental Protection Data; Research on SQL Performance Optimization of CRM Stored Procedure Design of E-Archives Portfolio System Based on Signature TechnologyMLTwig: A Multi-Layer Tree Pattern Matching Approach for XQuery; Research and Implementation on Compression, Encryption, Storage and Retrieval System for Massive Data; The Research of Distributed Bitmap Index; Analysis of Distributed Computing Architecture Search Principle Based on Hadoop; Study of Network Public Opinion Classification Method Based on Naive Bayesian Algorithm in Hadoop Environment; Study on Object-Storage System Metadata Load Balancing; Research on PPHIIS Based on Ontology Model Online Data Compression Technique for Real Time Data of Energy Management System in the Industrial ProductionChapter 2: Parallel and Distributed Computing; Time Synchronization Method for Parallel Traffic Simulation Framework; Comparison of Parallel Computing Methods for Fast Cone-Beam Reconstruction with Similar Optimization Strategies; Research on Parallel Yen Algorithms on GPUs Using CUDA; Parallelization Analysis of Dissolved Gases in Transformer Oil Based on Random Forest Algorithm; GPU Accelerated Reconstruction in Compton Scattering Tomography Using Matrix Compression Parallel Scheduling Algorithms Investigation of Support Strict Resource Reservation from GridChapter 3: Computer Network Technology and Applications; A Dynamic Back-Off Algorithm in Ad Hoc Networks; A Fast Real-Time Scheduling Algorithm for WIA-PA; Research on Network Security Issues and Security Model; The Web Foreign Language Teaching Research Based on P2P Technology; A Multi-Redundancy Structure Model of Cloud Computing Digital Library; A Novel Mobility Management Scheme for Hierarchical MIPv6 Network; A Novel Response Time-Driven Replica Selection Approach for Cloud Computing A Secure Mobile Payments Protocol Based on ECCA Security Routing Protocol Based on Convergence Degree and Trust; A Trust System Design for Future SCADA Network Security; The Micro-Blogging Network Leading Group Recognition Algorithm; The Design and Implementation of an Optimized MPTCP Data Scheduling Algorithm; The Design of PMP-AODV Routing Protocol in Wireless Mesh Network; An Attribute Mapping Technique for Secure Interoperation in Multi-Domain Environments; An Authentication Scheme Based on the Light-Weight Rainbow Signature for Wireless Sensor Network |
| ctrlnum | (OCoLC)878138238 |
| dewey-full | 004 |
| dewey-hundreds | 000 - Computer science, information, general works |
| dewey-ones | 004 - Computer science |
| dewey-raw | 004 |
| dewey-search | 004 |
| dewey-sort | 14 |
| dewey-tens | 000 - Computer science, information, general works |
| discipline | Informatik |
| format | Electronic Conference Proceeding eBook |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>08533cam a2200805 i 4500</leader><controlfield tag="001">ZDB-4-EBA-ocn878138238</controlfield><controlfield tag="003">OCoLC</controlfield><controlfield tag="005">20240705115654.0</controlfield><controlfield tag="006">m o d </controlfield><controlfield tag="007">cr cn|||||||||</controlfield><controlfield tag="008">140321t20142014sz ao ob 101 0 eng d</controlfield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">E7B</subfield><subfield code="b">eng</subfield><subfield code="e">rda</subfield><subfield code="e">pn</subfield><subfield code="c">E7B</subfield><subfield code="d">CUS</subfield><subfield code="d">OCLCO</subfield><subfield code="d">N$T</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCF</subfield><subfield code="d">EBLCP</subfield><subfield code="d">YDXCP</subfield><subfield code="d">DEBSZ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">LLB</subfield><subfield code="d">OCL</subfield><subfield code="d">OCLCO</subfield><subfield code="d">AZK</subfield><subfield code="d">OCLCO</subfield><subfield code="d">AGLDB</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">VTS</subfield><subfield code="d">STF</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">TTECH</subfield><subfield code="d">VLY</subfield><subfield code="d">AJS</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield></datafield><datafield tag="019" ind1=" " ind2=" "><subfield code="a">890755139</subfield><subfield code="a">927292833</subfield><subfield code="a">961494529</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038264002</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3038264008</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">9783038350194</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)878138238</subfield><subfield code="z">(OCoLC)890755139</subfield><subfield code="z">(OCoLC)927292833</subfield><subfield code="z">(OCoLC)961494529</subfield></datafield><datafield tag="050" ind1=" " ind2="4"><subfield code="a">QA75.5</subfield><subfield code="b">.C667 2014eb</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">COM</subfield><subfield code="x">013000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">COM</subfield><subfield code="x">014000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">COM</subfield><subfield code="x">018000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">COM</subfield><subfield code="x">067000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">COM</subfield><subfield code="x">032000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">COM</subfield><subfield code="x">037000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">COM</subfield><subfield code="x">052000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="082" ind1="7" ind2=" "><subfield code="a">004</subfield><subfield code="2">23</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">MAIN</subfield></datafield><datafield tag="111" ind1="2" ind2=" "><subfield code="a">International Forum on Computer and Information Technology</subfield><subfield code="d">(2013 :</subfield><subfield code="c">Shenzhen, China)</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Computer and information technology :</subfield><subfield code="b">selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China /</subfield><subfield code="c">edited by Prasad Yarlagadda, Seung-Bok Choi and Yun-Hae Kim.</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">[Zurich], Switzerland :</subfield><subfield code="b">Trans Tech Publications,</subfield><subfield code="c">[2014]</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">©2014</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (1711 pages) :</subfield><subfield code="b">illustrations (some color), graphs, photographs</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">computer</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">online resource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Applied Mechanics and Materials,</subfield><subfield code="x">1662-7482 ;</subfield><subfield code="v">Volume 519-520</subfield></datafield><datafield tag="504" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references at the end of each chapters and indexes.</subfield></datafield><datafield tag="588" ind1="0" ind2=" "><subfield code="a">Online resource; title from PDF title page (ebrary, viewed March 20, 2014).</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Collection of selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China. The 335 papers are grouped as follows: Chapter 1: Databases, Data Processing and Data Management, Chapter 2: Parallel and Distributed Computing, Chapter 3: Computer Network Technology and Applications, Chapter 4: Software Engineering, Chapter 5: E-Commerce and E-Government, Chapter 6: Multimedia Technology and Application, Chapter 7: Computer Vision and Image Processing Technology, Chapter 8: Artificial Intelligence, Intelligent Algorithms and Computational Mathematics, Chapter 9: Computer Aided Design and Research, Chapter 10: Communications Technology and Signal Processing, Chapter 11: Electronic Devices and Embedded Systems, Chapter 12: Intelligent Instruments, Techniques for Detection and Testing, Sensors and Measurement, Chapter 13: Automation and Control, Chapter 14: Information Technologies in Engineering Management, Chapter 15: Enterprise Resource Planning and Management System, Chapter 16: Information Technologies in Education Keyword: Databases, Data Processing and Data Management, Parallel and Distributed Computing, Computer Network Technology and Applications, Software Engineering, E-Commerce and E-Government, Multimedia Technology and Application, Computer Vision and Image Processing Technology, Artificial Intelligence, Intelligent Algorithms and Computational Mathematics, Computer Aided Design and Research, Communications Technology and Signal Processing, Electronic Devices and Embedded Systems, Intelligent Instruments, Techniques for Detection and Testing, Sensors and Measurement, Automation and Control, Information Technologies in Engineering Management, Enterprise Resource Planning and Management System, Information Technologies in Education.</subfield></datafield><datafield tag="505" ind1="0" ind2=" "><subfield code="a">Computer and Information Technology; Preface and Conference Organization; Table of Contents; Chapter 1: Databases, Data Processing and Data Management; A Framework for Processing Water Resources Big Data and Application; Accurate Location in Batch Dynamic Provable Data Possession; Construction of Data Warehouse Platform in Continual Quality Improvement; Research on Technology of CRM Stored Procedure; Research on the Integration Technology of Marine Environmental Protection Data; Research on SQL Performance Optimization of CRM Stored Procedure</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Design of E-Archives Portfolio System Based on Signature TechnologyMLTwig: A Multi-Layer Tree Pattern Matching Approach for XQuery; Research and Implementation on Compression, Encryption, Storage and Retrieval System for Massive Data; The Research of Distributed Bitmap Index; Analysis of Distributed Computing Architecture Search Principle Based on Hadoop; Study of Network Public Opinion Classification Method Based on Naive Bayesian Algorithm in Hadoop Environment; Study on Object-Storage System Metadata Load Balancing; Research on PPHIIS Based on Ontology Model</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Online Data Compression Technique for Real Time Data of Energy Management System in the Industrial ProductionChapter 2: Parallel and Distributed Computing; Time Synchronization Method for Parallel Traffic Simulation Framework; Comparison of Parallel Computing Methods for Fast Cone-Beam Reconstruction with Similar Optimization Strategies; Research on Parallel Yen Algorithms on GPUs Using CUDA; Parallelization Analysis of Dissolved Gases in Transformer Oil Based on Random Forest Algorithm; GPU Accelerated Reconstruction in Compton Scattering Tomography Using Matrix Compression</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Parallel Scheduling Algorithms Investigation of Support Strict Resource Reservation from GridChapter 3: Computer Network Technology and Applications; A Dynamic Back-Off Algorithm in Ad Hoc Networks; A Fast Real-Time Scheduling Algorithm for WIA-PA; Research on Network Security Issues and Security Model; The Web Foreign Language Teaching Research Based on P2P Technology; A Multi-Redundancy Structure Model of Cloud Computing Digital Library; A Novel Mobility Management Scheme for Hierarchical MIPv6 Network; A Novel Response Time-Driven Replica Selection Approach for Cloud Computing</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">A Secure Mobile Payments Protocol Based on ECCA Security Routing Protocol Based on Convergence Degree and Trust; A Trust System Design for Future SCADA Network Security; The Micro-Blogging Network Leading Group Recognition Algorithm; The Design and Implementation of an Optimized MPTCP Data Scheduling Algorithm; The Design of PMP-AODV Routing Protocol in Wireless Mesh Network; An Attribute Mapping Technique for Secure Interoperation in Multi-Domain Environments; An Authentication Scheme Based on the Light-Weight Rainbow Signature for Wireless Sensor Network</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Computer science</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Information technology</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Informatique</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Technologie de l'information</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">COMPUTERS</subfield><subfield code="x">Computer Literacy.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">COMPUTERS</subfield><subfield code="x">Computer Science.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">COMPUTERS</subfield><subfield code="x">Data Processing.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">COMPUTERS</subfield><subfield code="x">Hardware</subfield><subfield code="x">General.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">COMPUTERS</subfield><subfield code="x">Information Technology.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">COMPUTERS</subfield><subfield code="x">Machine Theory.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">COMPUTERS</subfield><subfield code="x">Reference.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Computer science</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Information technology</subfield><subfield code="2">fast</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">Conference papers and proceedings</subfield><subfield code="2">fast</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Yarlagadda, Prasad K. D. V.,</subfield><subfield code="e">editor.</subfield><subfield code="0">http://id.loc.gov/authorities/names/no2012045174</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Choi, Seung-Bok,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Kim, Yun-Hae,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Print version:</subfield><subfield code="t">Computer and information technology : selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China.</subfield><subfield code="d">Zurich, Switzerland : TTP, ©2014</subfield><subfield code="h">1713 pages</subfield><subfield code="k">Applied mechanics and materials ; Volume 519-520</subfield><subfield code="x">1662-7482</subfield><subfield code="z">9783038350194</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Applied mechanics and materials ;</subfield><subfield code="v">v. 519-520.</subfield><subfield code="0">http://id.loc.gov/authorities/names/no2009039852</subfield></datafield><datafield tag="856" ind1="1" ind2=" "><subfield code="l">FWS01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711963</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="856" ind1="1" ind2=" "><subfield code="l">CBO01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711963</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">ProQuest Ebook Central</subfield><subfield code="b">EBLB</subfield><subfield code="n">EBL1910716</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">ebrary</subfield><subfield code="b">EBRY</subfield><subfield code="n">ebr10846239</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">EBSCOhost</subfield><subfield code="b">EBSC</subfield><subfield code="n">711963</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">Trans Tech Publications, Ltd</subfield><subfield code="b">TRAN</subfield><subfield code="n">10.4028/www.scientific.net/AMM.519-520</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">YBP Library Services</subfield><subfield code="b">YANK</subfield><subfield code="n">11697652</subfield></datafield><datafield tag="994" ind1=" " ind2=" "><subfield code="a">92</subfield><subfield code="b">GEBAY</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield></record></collection> |
| genre | Conference papers and proceedings fast |
| genre_facet | Conference papers and proceedings |
| id | ZDB-4-EBA-ocn878138238 |
| illustrated | Illustrated |
| indexdate | 2024-10-25T16:21:58Z |
| institution | BVB |
| isbn | 9783038264002 3038264008 |
| issn | 1662-7482 ; 1662-7482 |
| language | English |
| oclc_num | 878138238 |
| open_access_boolean | |
| owner | MAIN |
| owner_facet | MAIN |
| physical | 1 online resource (1711 pages) : illustrations (some color), graphs, photographs |
| psigel | ZDB-4-EBA |
| publishDate | 2014 |
| publishDateSearch | 2014 |
| publishDateSort | 2014 |
| publisher | Trans Tech Publications, |
| record_format | marc |
| series | Applied mechanics and materials ; |
| series2 | Applied Mechanics and Materials, |
| spelling | International Forum on Computer and Information Technology (2013 : Shenzhen, China) Computer and information technology : selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China / edited by Prasad Yarlagadda, Seung-Bok Choi and Yun-Hae Kim. [Zurich], Switzerland : Trans Tech Publications, [2014] ©2014 1 online resource (1711 pages) : illustrations (some color), graphs, photographs text txt rdacontent computer c rdamedia online resource cr rdacarrier Applied Mechanics and Materials, 1662-7482 ; Volume 519-520 Includes bibliographical references at the end of each chapters and indexes. Online resource; title from PDF title page (ebrary, viewed March 20, 2014). Collection of selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China. The 335 papers are grouped as follows: Chapter 1: Databases, Data Processing and Data Management, Chapter 2: Parallel and Distributed Computing, Chapter 3: Computer Network Technology and Applications, Chapter 4: Software Engineering, Chapter 5: E-Commerce and E-Government, Chapter 6: Multimedia Technology and Application, Chapter 7: Computer Vision and Image Processing Technology, Chapter 8: Artificial Intelligence, Intelligent Algorithms and Computational Mathematics, Chapter 9: Computer Aided Design and Research, Chapter 10: Communications Technology and Signal Processing, Chapter 11: Electronic Devices and Embedded Systems, Chapter 12: Intelligent Instruments, Techniques for Detection and Testing, Sensors and Measurement, Chapter 13: Automation and Control, Chapter 14: Information Technologies in Engineering Management, Chapter 15: Enterprise Resource Planning and Management System, Chapter 16: Information Technologies in Education Keyword: Databases, Data Processing and Data Management, Parallel and Distributed Computing, Computer Network Technology and Applications, Software Engineering, E-Commerce and E-Government, Multimedia Technology and Application, Computer Vision and Image Processing Technology, Artificial Intelligence, Intelligent Algorithms and Computational Mathematics, Computer Aided Design and Research, Communications Technology and Signal Processing, Electronic Devices and Embedded Systems, Intelligent Instruments, Techniques for Detection and Testing, Sensors and Measurement, Automation and Control, Information Technologies in Engineering Management, Enterprise Resource Planning and Management System, Information Technologies in Education. Computer and Information Technology; Preface and Conference Organization; Table of Contents; Chapter 1: Databases, Data Processing and Data Management; A Framework for Processing Water Resources Big Data and Application; Accurate Location in Batch Dynamic Provable Data Possession; Construction of Data Warehouse Platform in Continual Quality Improvement; Research on Technology of CRM Stored Procedure; Research on the Integration Technology of Marine Environmental Protection Data; Research on SQL Performance Optimization of CRM Stored Procedure Design of E-Archives Portfolio System Based on Signature TechnologyMLTwig: A Multi-Layer Tree Pattern Matching Approach for XQuery; Research and Implementation on Compression, Encryption, Storage and Retrieval System for Massive Data; The Research of Distributed Bitmap Index; Analysis of Distributed Computing Architecture Search Principle Based on Hadoop; Study of Network Public Opinion Classification Method Based on Naive Bayesian Algorithm in Hadoop Environment; Study on Object-Storage System Metadata Load Balancing; Research on PPHIIS Based on Ontology Model Online Data Compression Technique for Real Time Data of Energy Management System in the Industrial ProductionChapter 2: Parallel and Distributed Computing; Time Synchronization Method for Parallel Traffic Simulation Framework; Comparison of Parallel Computing Methods for Fast Cone-Beam Reconstruction with Similar Optimization Strategies; Research on Parallel Yen Algorithms on GPUs Using CUDA; Parallelization Analysis of Dissolved Gases in Transformer Oil Based on Random Forest Algorithm; GPU Accelerated Reconstruction in Compton Scattering Tomography Using Matrix Compression Parallel Scheduling Algorithms Investigation of Support Strict Resource Reservation from GridChapter 3: Computer Network Technology and Applications; A Dynamic Back-Off Algorithm in Ad Hoc Networks; A Fast Real-Time Scheduling Algorithm for WIA-PA; Research on Network Security Issues and Security Model; The Web Foreign Language Teaching Research Based on P2P Technology; A Multi-Redundancy Structure Model of Cloud Computing Digital Library; A Novel Mobility Management Scheme for Hierarchical MIPv6 Network; A Novel Response Time-Driven Replica Selection Approach for Cloud Computing A Secure Mobile Payments Protocol Based on ECCA Security Routing Protocol Based on Convergence Degree and Trust; A Trust System Design for Future SCADA Network Security; The Micro-Blogging Network Leading Group Recognition Algorithm; The Design and Implementation of an Optimized MPTCP Data Scheduling Algorithm; The Design of PMP-AODV Routing Protocol in Wireless Mesh Network; An Attribute Mapping Technique for Secure Interoperation in Multi-Domain Environments; An Authentication Scheme Based on the Light-Weight Rainbow Signature for Wireless Sensor Network Computer science Congresses. Information technology Congresses. Informatique Congrès. Technologie de l'information Congrès. COMPUTERS Computer Literacy. bisacsh COMPUTERS Computer Science. bisacsh COMPUTERS Data Processing. bisacsh COMPUTERS Hardware General. bisacsh COMPUTERS Information Technology. bisacsh COMPUTERS Machine Theory. bisacsh COMPUTERS Reference. bisacsh Computer science fast Information technology fast Conference papers and proceedings fast Yarlagadda, Prasad K. D. V., editor. http://id.loc.gov/authorities/names/no2012045174 Choi, Seung-Bok, editor. Kim, Yun-Hae, editor. Print version: Computer and information technology : selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China. Zurich, Switzerland : TTP, ©2014 1713 pages Applied mechanics and materials ; Volume 519-520 1662-7482 9783038350194 Applied mechanics and materials ; v. 519-520. http://id.loc.gov/authorities/names/no2009039852 FWS01 ZDB-4-EBA FWS_PDA_EBA https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711963 Volltext CBO01 ZDB-4-EBA FWS_PDA_EBA https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711963 Volltext |
| spellingShingle | Computer and information technology : selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China / Applied mechanics and materials ; Computer and Information Technology; Preface and Conference Organization; Table of Contents; Chapter 1: Databases, Data Processing and Data Management; A Framework for Processing Water Resources Big Data and Application; Accurate Location in Batch Dynamic Provable Data Possession; Construction of Data Warehouse Platform in Continual Quality Improvement; Research on Technology of CRM Stored Procedure; Research on the Integration Technology of Marine Environmental Protection Data; Research on SQL Performance Optimization of CRM Stored Procedure Design of E-Archives Portfolio System Based on Signature TechnologyMLTwig: A Multi-Layer Tree Pattern Matching Approach for XQuery; Research and Implementation on Compression, Encryption, Storage and Retrieval System for Massive Data; The Research of Distributed Bitmap Index; Analysis of Distributed Computing Architecture Search Principle Based on Hadoop; Study of Network Public Opinion Classification Method Based on Naive Bayesian Algorithm in Hadoop Environment; Study on Object-Storage System Metadata Load Balancing; Research on PPHIIS Based on Ontology Model Online Data Compression Technique for Real Time Data of Energy Management System in the Industrial ProductionChapter 2: Parallel and Distributed Computing; Time Synchronization Method for Parallel Traffic Simulation Framework; Comparison of Parallel Computing Methods for Fast Cone-Beam Reconstruction with Similar Optimization Strategies; Research on Parallel Yen Algorithms on GPUs Using CUDA; Parallelization Analysis of Dissolved Gases in Transformer Oil Based on Random Forest Algorithm; GPU Accelerated Reconstruction in Compton Scattering Tomography Using Matrix Compression Parallel Scheduling Algorithms Investigation of Support Strict Resource Reservation from GridChapter 3: Computer Network Technology and Applications; A Dynamic Back-Off Algorithm in Ad Hoc Networks; A Fast Real-Time Scheduling Algorithm for WIA-PA; Research on Network Security Issues and Security Model; The Web Foreign Language Teaching Research Based on P2P Technology; A Multi-Redundancy Structure Model of Cloud Computing Digital Library; A Novel Mobility Management Scheme for Hierarchical MIPv6 Network; A Novel Response Time-Driven Replica Selection Approach for Cloud Computing A Secure Mobile Payments Protocol Based on ECCA Security Routing Protocol Based on Convergence Degree and Trust; A Trust System Design for Future SCADA Network Security; The Micro-Blogging Network Leading Group Recognition Algorithm; The Design and Implementation of an Optimized MPTCP Data Scheduling Algorithm; The Design of PMP-AODV Routing Protocol in Wireless Mesh Network; An Attribute Mapping Technique for Secure Interoperation in Multi-Domain Environments; An Authentication Scheme Based on the Light-Weight Rainbow Signature for Wireless Sensor Network Computer science Congresses. Information technology Congresses. Informatique Congrès. Technologie de l'information Congrès. COMPUTERS Computer Literacy. bisacsh COMPUTERS Computer Science. bisacsh COMPUTERS Data Processing. bisacsh COMPUTERS Hardware General. bisacsh COMPUTERS Information Technology. bisacsh COMPUTERS Machine Theory. bisacsh COMPUTERS Reference. bisacsh Computer science fast Information technology fast |
| title | Computer and information technology : selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China / |
| title_auth | Computer and information technology : selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China / |
| title_exact_search | Computer and information technology : selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China / |
| title_full | Computer and information technology : selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China / edited by Prasad Yarlagadda, Seung-Bok Choi and Yun-Hae Kim. |
| title_fullStr | Computer and information technology : selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China / edited by Prasad Yarlagadda, Seung-Bok Choi and Yun-Hae Kim. |
| title_full_unstemmed | Computer and information technology : selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China / edited by Prasad Yarlagadda, Seung-Bok Choi and Yun-Hae Kim. |
| title_short | Computer and information technology : |
| title_sort | computer and information technology selected peer reviewed papers from the international forum on computer and information technology ifcit 2013 december 24 25 2013 shenzhen china |
| title_sub | selected, peer reviewed papers from the International Forum on Computer and Information Technology (IFCIT 2013), December 24-25, 2013, Shenzhen, China / |
| topic | Computer science Congresses. Information technology Congresses. Informatique Congrès. Technologie de l'information Congrès. COMPUTERS Computer Literacy. bisacsh COMPUTERS Computer Science. bisacsh COMPUTERS Data Processing. bisacsh COMPUTERS Hardware General. bisacsh COMPUTERS Information Technology. bisacsh COMPUTERS Machine Theory. bisacsh COMPUTERS Reference. bisacsh Computer science fast Information technology fast |
| topic_facet | Computer science Congresses. Information technology Congresses. Informatique Congrès. Technologie de l'information Congrès. COMPUTERS Computer Literacy. COMPUTERS Computer Science. COMPUTERS Data Processing. COMPUTERS Hardware General. COMPUTERS Information Technology. COMPUTERS Machine Theory. COMPUTERS Reference. Computer science Information technology Conference papers and proceedings |
| url | https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711963 |
| work_keys_str_mv | AT internationalforumoncomputerandinformationtechnologyshenzhenchina computerandinformationtechnologyselectedpeerreviewedpapersfromtheinternationalforumoncomputerandinformationtechnologyifcit2013december24252013shenzhenchina AT yarlagaddaprasadkdv computerandinformationtechnologyselectedpeerreviewedpapersfromtheinternationalforumoncomputerandinformationtechnologyifcit2013december24252013shenzhenchina AT choiseungbok computerandinformationtechnologyselectedpeerreviewedpapersfromtheinternationalforumoncomputerandinformationtechnologyifcit2013december24252013shenzhenchina AT kimyunhae computerandinformationtechnologyselectedpeerreviewedpapersfromtheinternationalforumoncomputerandinformationtechnologyifcit2013december24252013shenzhenchina |