Advanced manufacturing technology :: selected, peer reviewed papers from the 2010 International Conference on Advances in Materials and Manufacturing Processes (ICAMMP 2010), 6-8 November, 2010, Shenzhen, China /
"This book aims to collect the latest advancement and applications of robotics, artificial intelligence, programmable controllers, lasers and other advanced processes, programmable assembly, flexible manufacturing systems, inspection; automatic test equipment, simulation, motors, controls and d...
Saved in:
Corporate Author: | |
---|---|
Other Authors: | , , |
Format: | Electronic Conference Proceeding eBook |
Language: | English |
Published: |
Stafa-Zurich, Switzerland ; Enfield, NH :
Trans Tech Publications,
[2011]
|
Series: | Advanced materials research ;
v. 156-157. |
Subjects: | |
Online Access: | DE-862 DE-863 |
Summary: | "This book aims to collect the latest advancement and applications of robotics, artificial intelligence, programmable controllers, lasers and other advanced processes, programmable assembly, flexible manufacturing systems, inspection; automatic test equipment, simulation, motors, controls and drives, local area networking, computer integrated manufacturing, production planning and control, logistics and supply chain management, human factors, and economics"--Preface |
Physical Description: | 1 online resource (1778 pages) : illustrations (some color) |
Bibliography: | Includes bibliographical references and indexes. |
ISBN: | 9783038135579 3038135577 |
ISSN: | 1022-6680 ; 1022-6680 |
Staff View
MARC
LEADER | 00000cam a2200000 i 4500 | ||
---|---|---|---|
001 | ZDB-4-EBA-ocn865823228 | ||
003 | OCoLC | ||
005 | 20250103110447.0 | ||
006 | m o d | ||
007 | cr cn||||||||| | ||
008 | 110425t20112011sz ad ob 101 0 eng d | ||
040 | |a E7B |b eng |e rda |e pn |c E7B |d N$T |d YDXCP |d OCLCO |d OCLCF |d MUU |d CUS |d OCLCO |d EBLCP |d DEBSZ |d OCLCO |d OCLCQ |d OCLCO |d OCL |d OCLCO |d AGLDB |d OCLCQ |d VTS |d STF |d M8D |d OCLCQ |d OCLCO |d OCLCQ |d VLY |d AJS |d OCLCO |d OCLCQ |d UKAHL |d OCLCO |d OCLCL | ||
019 | |a 698755789 |a 865493791 |a 872673395 |a 897640762 |a 904110514 | ||
020 | |a 9783038135579 |q (electronic bk.) | ||
020 | |a 3038135577 |q (electronic bk.) | ||
020 | |z 9780878492053 |q (pbk.) | ||
020 | |z 0878492054 |q (pbk.) | ||
035 | |a (OCoLC)865823228 |z (OCoLC)698755789 |z (OCoLC)865493791 |z (OCoLC)872673395 |z (OCoLC)897640762 |z (OCoLC)904110514 | ||
050 | 4 | |a TS183 |b .I557 2010eb | |
050 | 4 | |a TA401.3 |b .A3eb | |
072 | 7 | |a TEC |x 009060 |2 bisacsh | |
072 | 7 | |a TEC |x 018000 |2 bisacsh | |
072 | 7 | |a TEC |x 020000 |2 bisacsh | |
072 | 7 | |a TEC |x 040000 |2 bisacsh | |
082 | 7 | |a 670.4275 |2 22 | |
049 | |a MAIN | ||
111 | 2 | |a International Conference on Advances in Materials and Manufacturing Processes |d (2010 : |c Shenzhen Shi, China), |j issuing body. |0 http://id.loc.gov/authorities/names/no2011015204 | |
245 | 1 | 0 | |a Advanced manufacturing technology : |b selected, peer reviewed papers from the 2010 International Conference on Advances in Materials and Manufacturing Processes (ICAMMP 2010), 6-8 November, 2010, Shenzhen, China / |c edited by Jingtao Han, Zhengyi Jiang and Sihai Jiao. |
246 | 3 | |a ICAMMP 2010 | |
264 | 1 | |a Stafa-Zurich, Switzerland ; |a Enfield, NH : |b Trans Tech Publications, |c [2011] | |
264 | 4 | |c ©2011 | |
300 | |a 1 online resource (1778 pages) : |b illustrations (some color) | ||
336 | |a text |b txt |2 rdacontent | ||
337 | |a computer |b c |2 rdamedia | ||
338 | |a online resource |b cr |2 rdacarrier | ||
490 | 1 | |a Advanced materials research, |x 1022-6680 ; |v volumes 156-157 | |
504 | |a Includes bibliographical references and indexes. | ||
588 | 0 | |a Print version record. | |
520 | |a "This book aims to collect the latest advancement and applications of robotics, artificial intelligence, programmable controllers, lasers and other advanced processes, programmable assembly, flexible manufacturing systems, inspection; automatic test equipment, simulation, motors, controls and drives, local area networking, computer integrated manufacturing, production planning and control, logistics and supply chain management, human factors, and economics"--Preface | ||
505 | 0 | |a Advanced Manufacturing Technology, ICAMMP 2010; Sponsors, Preface; Table of Contents; Development of a Multi-Quantum-Well Spatial Light Modulator and its Nonlinear Electro-Optical Driving Circuit; Study on the Algorithms of Holes Feature Recognition in Auto Body Panels Based on UG; A Two-Stage Optimization Method for the Stencil Printing Process Based on Neural Network and Response Surface Method; A Joint Model of Production and Preventive Maintenance Plan; Processing of Human Feces Using Beanstalk and Sawdust as Matrix in a Composting-Type Eco-Toilet | |
505 | 8 | |a Study and Preparation of Electrocatalytic Ceramic Membrane ElectrodeAugmented Product Modeling Technique in New Product Development; Adsorption of Arsenic (III) onto Modified Magnetic Microspheres; Preparation of Novel Amino-Functionalized Ionic Liquids and their Application; Multi-Population Multi-Objective Cultural Algorithm; Quick Verification Technology of Coordinate Measuring Arm; Matter Element Digraph Based Workflow Modeling; A New Experimental Approach for Determination the Effect of Tool Flank Wear Length on Cutting Temperature Distributions | |
505 | 8 | |a Characteristic of Cu-Based Catalytic Coating for Methanol Steam Reforming Prepared by Cold SprayResearch Finite Element Method Mesh Generation Based on Material-Discontinuous-Nature; Comprehensive Evaluation Index System in the Application for Earthquake Emergency Shelter Site; Experimental Study on New Technology for Solidifying/Stabilizing Papermaking Sludge; Numerical Simulation for Magnetic Fluid Inclination Sensor; Effect of Process Parameters on Solid Fuel Briquette of Rice and Soybean Straw; A Fast Retrieval Method Based on K-Means Clustering for Mechanical Product Design | |
505 | 8 | |a Research on the Optimization Algorithm of NC Tool-Path for Scanning PointsCrystal Structure and Electrochemical Properties of AB3.8-Type Earth Mg Ni-Based Hydrogen Storage Alloys; A Novel Evaluation Method for Overall Performance Testing of Rail Transit Brake System; Finite Element Analysis of Temperature Characteristicon the Pressure Sensor Based on the Shell of Piezo Gauge; Study on Energy-Saving Product Concept Design Based on TRIZ and Function Analysis; Treatment of Lake-Type Raw Water by Ultrasonic and Photocatalytic Oxidization Process | |
650 | 0 | |a Materials science |v Congresses. | |
650 | 0 | |a Manufacturing processes |x Data processing |v Congresses. | |
650 | 0 | |a Manufacturing processes |x Automation |v Congresses. | |
650 | 0 | |a Production control |x Automation |v Congresses. | |
650 | 0 | |a CAD/CAM systems. |0 http://id.loc.gov/authorities/subjects/sh85018610 | |
650 | 6 | |a Science des matériaux |v Congrès. | |
650 | 6 | |a Fabrication |x Informatique |v Congrès. | |
650 | 6 | |a Fabrication |x Automatisation |v Congrès. | |
650 | 6 | |a Production |x Contrôle |x Automatisation |v Congrès. | |
650 | 6 | |a Systèmes de CFAO. | |
650 | 7 | |a TECHNOLOGY & ENGINEERING |x Industrial Engineering. |2 bisacsh | |
650 | 7 | |a TECHNOLOGY & ENGINEERING |x Industrial Technology. |2 bisacsh | |
650 | 7 | |a TECHNOLOGY & ENGINEERING |x Manufacturing. |2 bisacsh | |
650 | 7 | |a TECHNOLOGY & ENGINEERING |x Technical & Manufacturing Industries & Trades. |2 bisacsh | |
650 | 7 | |a CAD/CAM systems |2 fast | |
650 | 7 | |a Manufacturing processes |x Automation |2 fast | |
650 | 7 | |a Manufacturing processes |x Data processing |2 fast | |
650 | 7 | |a Materials science |2 fast | |
650 | 7 | |a Production control |x Automation |2 fast | |
655 | 7 | |a proceedings (reports) |2 aat | |
655 | 7 | |a Conference papers and proceedings |2 fast | |
655 | 7 | |a Conference papers and proceedings. |2 lcgft |0 http://id.loc.gov/authorities/genreForms/gf2014026068 | |
655 | 7 | |a Actes de congrès. |2 rvmgf | |
700 | 1 | |a Han, Jingtao. |0 http://id.loc.gov/authorities/names/nb2011001690 | |
700 | 1 | |a Jiang, Zhengyi. | |
700 | 1 | |a Jiao, Sihai. |0 http://id.loc.gov/authorities/names/no2011011798 | |
758 | |i has work: |a Advanced manufacturing technology (Text) |1 https://id.oclc.org/worldcat/entity/E39PCGVVhHHy49jMqhvV9gDMMX |4 https://id.oclc.org/worldcat/ontology/hasWork | ||
776 | 0 | 8 | |i Print version: |a International Conference on Advances in Materials and Manufacturing Processes. |t Advanced manufacturing technology : selected, peer reviewed papers from the 2010 International Conference on Advances in Materials and Manufacturing Processes (ICAMMP 2010), 6-8 November, 2010, Shenzhen, China. |d Stafa-Zurich, Switzerland : Trans Tech Publications, [2011] |h 2 volumes in 1 ; 25 cm. |k Advanced materials research ; volumes 156-157 |x 1022-6680 |z 9780878492053 |w (DLC) 2011286720 |w (OCoLC)751515820 |
830 | 0 | |a Advanced materials research ; |v v. 156-157. |0 http://id.loc.gov/authorities/names/n99255722 | |
966 | 4 | 0 | |l DE-862 |p ZDB-4-EBA |q FWS_PDA_EBA |u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=553105 |3 Volltext |
966 | 4 | 0 | |l DE-863 |p ZDB-4-EBA |q FWS_PDA_EBA |u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=553105 |3 Volltext |
936 | |a BATCHLOAD | ||
938 | |a Askews and Holts Library Services |b ASKH |n BDZ0025028950 | ||
938 | |a ProQuest Ebook Central |b EBLB |n EBL1872501 | ||
938 | |a ebrary |b EBRY |n ebr10814229 | ||
938 | |a EBSCOhost |b EBSC |n 553105 | ||
938 | |a YBP Library Services |b YANK |n 10406081 | ||
994 | |a 92 |b GEBAY | ||
912 | |a ZDB-4-EBA | ||
049 | |a DE-862 | ||
049 | |a DE-863 |
Record in the Search Index
DE-BY-FWS_katkey | ZDB-4-EBA-ocn865823228 |
---|---|
_version_ | 1829094979046211584 |
adam_text | |
any_adam_object | |
author2 | Han, Jingtao Jiang, Zhengyi Jiao, Sihai |
author2_role | |
author2_variant | j h jh z j zj s j sj |
author_GND | http://id.loc.gov/authorities/names/nb2011001690 http://id.loc.gov/authorities/names/no2011011798 |
author_corporate | International Conference on Advances in Materials and Manufacturing Processes Shenzhen Shi, China |
author_corporate_role | |
author_facet | Han, Jingtao Jiang, Zhengyi Jiao, Sihai International Conference on Advances in Materials and Manufacturing Processes Shenzhen Shi, China |
author_sort | International Conference on Advances in Materials and Manufacturing Processes Shenzhen Shi, China |
building | Verbundindex |
bvnumber | localFWS |
callnumber-first | T - Technology |
callnumber-label | TS183 |
callnumber-raw | TS183 .I557 2010eb TA401.3 .A3eb |
callnumber-search | TS183 .I557 2010eb TA401.3 .A3eb |
callnumber-sort | TS 3183 I557 42010EB |
callnumber-subject | TS - Manufactures |
collection | ZDB-4-EBA |
contents | Advanced Manufacturing Technology, ICAMMP 2010; Sponsors, Preface; Table of Contents; Development of a Multi-Quantum-Well Spatial Light Modulator and its Nonlinear Electro-Optical Driving Circuit; Study on the Algorithms of Holes Feature Recognition in Auto Body Panels Based on UG; A Two-Stage Optimization Method for the Stencil Printing Process Based on Neural Network and Response Surface Method; A Joint Model of Production and Preventive Maintenance Plan; Processing of Human Feces Using Beanstalk and Sawdust as Matrix in a Composting-Type Eco-Toilet Study and Preparation of Electrocatalytic Ceramic Membrane ElectrodeAugmented Product Modeling Technique in New Product Development; Adsorption of Arsenic (III) onto Modified Magnetic Microspheres; Preparation of Novel Amino-Functionalized Ionic Liquids and their Application; Multi-Population Multi-Objective Cultural Algorithm; Quick Verification Technology of Coordinate Measuring Arm; Matter Element Digraph Based Workflow Modeling; A New Experimental Approach for Determination the Effect of Tool Flank Wear Length on Cutting Temperature Distributions Characteristic of Cu-Based Catalytic Coating for Methanol Steam Reforming Prepared by Cold SprayResearch Finite Element Method Mesh Generation Based on Material-Discontinuous-Nature; Comprehensive Evaluation Index System in the Application for Earthquake Emergency Shelter Site; Experimental Study on New Technology for Solidifying/Stabilizing Papermaking Sludge; Numerical Simulation for Magnetic Fluid Inclination Sensor; Effect of Process Parameters on Solid Fuel Briquette of Rice and Soybean Straw; A Fast Retrieval Method Based on K-Means Clustering for Mechanical Product Design Research on the Optimization Algorithm of NC Tool-Path for Scanning PointsCrystal Structure and Electrochemical Properties of AB3.8-Type Earth Mg Ni-Based Hydrogen Storage Alloys; A Novel Evaluation Method for Overall Performance Testing of Rail Transit Brake System; Finite Element Analysis of Temperature Characteristicon the Pressure Sensor Based on the Shell of Piezo Gauge; Study on Energy-Saving Product Concept Design Based on TRIZ and Function Analysis; Treatment of Lake-Type Raw Water by Ultrasonic and Photocatalytic Oxidization Process |
ctrlnum | (OCoLC)865823228 |
dewey-full | 670.4275 |
dewey-hundreds | 600 - Technology (Applied sciences) |
dewey-ones | 670 - Manufacturing |
dewey-raw | 670.4275 |
dewey-search | 670.4275 |
dewey-sort | 3670.4275 |
dewey-tens | 670 - Manufacturing |
discipline | Werkstoffwissenschaften / Fertigungstechnik |
format | Electronic Conference Proceeding eBook |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>07673cam a2200925 i 4500</leader><controlfield tag="001">ZDB-4-EBA-ocn865823228</controlfield><controlfield tag="003">OCoLC</controlfield><controlfield tag="005">20250103110447.0</controlfield><controlfield tag="006">m o d </controlfield><controlfield tag="007">cr cn|||||||||</controlfield><controlfield tag="008">110425t20112011sz ad ob 101 0 eng d</controlfield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">E7B</subfield><subfield code="b">eng</subfield><subfield code="e">rda</subfield><subfield code="e">pn</subfield><subfield code="c">E7B</subfield><subfield code="d">N$T</subfield><subfield code="d">YDXCP</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCF</subfield><subfield code="d">MUU</subfield><subfield code="d">CUS</subfield><subfield code="d">OCLCO</subfield><subfield code="d">EBLCP</subfield><subfield code="d">DEBSZ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCL</subfield><subfield code="d">OCLCO</subfield><subfield code="d">AGLDB</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">VTS</subfield><subfield code="d">STF</subfield><subfield code="d">M8D</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">VLY</subfield><subfield code="d">AJS</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">UKAHL</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCL</subfield></datafield><datafield tag="019" ind1=" " ind2=" "><subfield code="a">698755789</subfield><subfield code="a">865493791</subfield><subfield code="a">872673395</subfield><subfield code="a">897640762</subfield><subfield code="a">904110514</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038135579</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3038135577</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">9780878492053</subfield><subfield code="q">(pbk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">0878492054</subfield><subfield code="q">(pbk.)</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)865823228</subfield><subfield code="z">(OCoLC)698755789</subfield><subfield code="z">(OCoLC)865493791</subfield><subfield code="z">(OCoLC)872673395</subfield><subfield code="z">(OCoLC)897640762</subfield><subfield code="z">(OCoLC)904110514</subfield></datafield><datafield tag="050" ind1=" " ind2="4"><subfield code="a">TS183</subfield><subfield code="b">.I557 2010eb</subfield></datafield><datafield tag="050" ind1=" " ind2="4"><subfield code="a">TA401.3</subfield><subfield code="b">.A3eb</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">TEC</subfield><subfield code="x">009060</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">TEC</subfield><subfield code="x">018000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">TEC</subfield><subfield code="x">020000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">TEC</subfield><subfield code="x">040000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="082" ind1="7" ind2=" "><subfield code="a">670.4275</subfield><subfield code="2">22</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">MAIN</subfield></datafield><datafield tag="111" ind1="2" ind2=" "><subfield code="a">International Conference on Advances in Materials and Manufacturing Processes</subfield><subfield code="d">(2010 :</subfield><subfield code="c">Shenzhen Shi, China),</subfield><subfield code="j">issuing body.</subfield><subfield code="0">http://id.loc.gov/authorities/names/no2011015204</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Advanced manufacturing technology :</subfield><subfield code="b">selected, peer reviewed papers from the 2010 International Conference on Advances in Materials and Manufacturing Processes (ICAMMP 2010), 6-8 November, 2010, Shenzhen, China /</subfield><subfield code="c">edited by Jingtao Han, Zhengyi Jiang and Sihai Jiao.</subfield></datafield><datafield tag="246" ind1="3" ind2=" "><subfield code="a">ICAMMP 2010</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Stafa-Zurich, Switzerland ;</subfield><subfield code="a">Enfield, NH :</subfield><subfield code="b">Trans Tech Publications,</subfield><subfield code="c">[2011]</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">©2011</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (1778 pages) :</subfield><subfield code="b">illustrations (some color)</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">computer</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">online resource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Advanced materials research,</subfield><subfield code="x">1022-6680 ;</subfield><subfield code="v">volumes 156-157</subfield></datafield><datafield tag="504" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references and indexes.</subfield></datafield><datafield tag="588" ind1="0" ind2=" "><subfield code="a">Print version record.</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">"This book aims to collect the latest advancement and applications of robotics, artificial intelligence, programmable controllers, lasers and other advanced processes, programmable assembly, flexible manufacturing systems, inspection; automatic test equipment, simulation, motors, controls and drives, local area networking, computer integrated manufacturing, production planning and control, logistics and supply chain management, human factors, and economics"--Preface</subfield></datafield><datafield tag="505" ind1="0" ind2=" "><subfield code="a">Advanced Manufacturing Technology, ICAMMP 2010; Sponsors, Preface; Table of Contents; Development of a Multi-Quantum-Well Spatial Light Modulator and its Nonlinear Electro-Optical Driving Circuit; Study on the Algorithms of Holes Feature Recognition in Auto Body Panels Based on UG; A Two-Stage Optimization Method for the Stencil Printing Process Based on Neural Network and Response Surface Method; A Joint Model of Production and Preventive Maintenance Plan; Processing of Human Feces Using Beanstalk and Sawdust as Matrix in a Composting-Type Eco-Toilet</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Study and Preparation of Electrocatalytic Ceramic Membrane ElectrodeAugmented Product Modeling Technique in New Product Development; Adsorption of Arsenic (III) onto Modified Magnetic Microspheres; Preparation of Novel Amino-Functionalized Ionic Liquids and their Application; Multi-Population Multi-Objective Cultural Algorithm; Quick Verification Technology of Coordinate Measuring Arm; Matter Element Digraph Based Workflow Modeling; A New Experimental Approach for Determination the Effect of Tool Flank Wear Length on Cutting Temperature Distributions</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Characteristic of Cu-Based Catalytic Coating for Methanol Steam Reforming Prepared by Cold SprayResearch Finite Element Method Mesh Generation Based on Material-Discontinuous-Nature; Comprehensive Evaluation Index System in the Application for Earthquake Emergency Shelter Site; Experimental Study on New Technology for Solidifying/Stabilizing Papermaking Sludge; Numerical Simulation for Magnetic Fluid Inclination Sensor; Effect of Process Parameters on Solid Fuel Briquette of Rice and Soybean Straw; A Fast Retrieval Method Based on K-Means Clustering for Mechanical Product Design</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Research on the Optimization Algorithm of NC Tool-Path for Scanning PointsCrystal Structure and Electrochemical Properties of AB3.8-Type Earth Mg Ni-Based Hydrogen Storage Alloys; A Novel Evaluation Method for Overall Performance Testing of Rail Transit Brake System; Finite Element Analysis of Temperature Characteristicon the Pressure Sensor Based on the Shell of Piezo Gauge; Study on Energy-Saving Product Concept Design Based on TRIZ and Function Analysis; Treatment of Lake-Type Raw Water by Ultrasonic and Photocatalytic Oxidization Process</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Materials science</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Manufacturing processes</subfield><subfield code="x">Data processing</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Manufacturing processes</subfield><subfield code="x">Automation</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Production control</subfield><subfield code="x">Automation</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">CAD/CAM systems.</subfield><subfield code="0">http://id.loc.gov/authorities/subjects/sh85018610</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Science des matériaux</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Fabrication</subfield><subfield code="x">Informatique</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Fabrication</subfield><subfield code="x">Automatisation</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Production</subfield><subfield code="x">Contrôle</subfield><subfield code="x">Automatisation</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Systèmes de CFAO.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING</subfield><subfield code="x">Industrial Engineering.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING</subfield><subfield code="x">Industrial Technology.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING</subfield><subfield code="x">Manufacturing.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING</subfield><subfield code="x">Technical & Manufacturing Industries & Trades.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">CAD/CAM systems</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Manufacturing processes</subfield><subfield code="x">Automation</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Manufacturing processes</subfield><subfield code="x">Data processing</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Materials science</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Production control</subfield><subfield code="x">Automation</subfield><subfield code="2">fast</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">proceedings (reports)</subfield><subfield code="2">aat</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">Conference papers and proceedings</subfield><subfield code="2">fast</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">Conference papers and proceedings.</subfield><subfield code="2">lcgft</subfield><subfield code="0">http://id.loc.gov/authorities/genreForms/gf2014026068</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">Actes de congrès.</subfield><subfield code="2">rvmgf</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Han, Jingtao.</subfield><subfield code="0">http://id.loc.gov/authorities/names/nb2011001690</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Jiang, Zhengyi.</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Jiao, Sihai.</subfield><subfield code="0">http://id.loc.gov/authorities/names/no2011011798</subfield></datafield><datafield tag="758" ind1=" " ind2=" "><subfield code="i">has work:</subfield><subfield code="a">Advanced manufacturing technology (Text)</subfield><subfield code="1">https://id.oclc.org/worldcat/entity/E39PCGVVhHHy49jMqhvV9gDMMX</subfield><subfield code="4">https://id.oclc.org/worldcat/ontology/hasWork</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Print version:</subfield><subfield code="a">International Conference on Advances in Materials and Manufacturing Processes.</subfield><subfield code="t">Advanced manufacturing technology : selected, peer reviewed papers from the 2010 International Conference on Advances in Materials and Manufacturing Processes (ICAMMP 2010), 6-8 November, 2010, Shenzhen, China.</subfield><subfield code="d">Stafa-Zurich, Switzerland : Trans Tech Publications, [2011]</subfield><subfield code="h">2 volumes in 1 ; 25 cm.</subfield><subfield code="k">Advanced materials research ; volumes 156-157</subfield><subfield code="x">1022-6680</subfield><subfield code="z">9780878492053</subfield><subfield code="w">(DLC) 2011286720</subfield><subfield code="w">(OCoLC)751515820</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Advanced materials research ;</subfield><subfield code="v">v. 156-157.</subfield><subfield code="0">http://id.loc.gov/authorities/names/n99255722</subfield></datafield><datafield tag="966" ind1="4" ind2="0"><subfield code="l">DE-862</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=553105</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="4" ind2="0"><subfield code="l">DE-863</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=553105</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="936" ind1=" " ind2=" "><subfield code="a">BATCHLOAD</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">Askews and Holts Library Services</subfield><subfield code="b">ASKH</subfield><subfield code="n">BDZ0025028950</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">ProQuest Ebook Central</subfield><subfield code="b">EBLB</subfield><subfield code="n">EBL1872501</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">ebrary</subfield><subfield code="b">EBRY</subfield><subfield code="n">ebr10814229</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">EBSCOhost</subfield><subfield code="b">EBSC</subfield><subfield code="n">553105</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">YBP Library Services</subfield><subfield code="b">YANK</subfield><subfield code="n">10406081</subfield></datafield><datafield tag="994" ind1=" " ind2=" "><subfield code="a">92</subfield><subfield code="b">GEBAY</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-862</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-863</subfield></datafield></record></collection> |
genre | proceedings (reports) aat Conference papers and proceedings fast Conference papers and proceedings. lcgft http://id.loc.gov/authorities/genreForms/gf2014026068 Actes de congrès. rvmgf |
genre_facet | proceedings (reports) Conference papers and proceedings Conference papers and proceedings. Actes de congrès. |
id | ZDB-4-EBA-ocn865823228 |
illustrated | Illustrated |
indexdate | 2025-04-11T08:41:43Z |
institution | BVB |
institution_GND | http://id.loc.gov/authorities/names/no2011015204 |
isbn | 9783038135579 3038135577 |
issn | 1022-6680 ; 1022-6680 |
language | English |
oclc_num | 865823228 |
open_access_boolean | |
owner | MAIN DE-862 DE-BY-FWS DE-863 DE-BY-FWS |
owner_facet | MAIN DE-862 DE-BY-FWS DE-863 DE-BY-FWS |
physical | 1 online resource (1778 pages) : illustrations (some color) |
psigel | ZDB-4-EBA FWS_PDA_EBA ZDB-4-EBA |
publishDate | 2011 |
publishDateSearch | 2011 |
publishDateSort | 2011 |
publisher | Trans Tech Publications, |
record_format | marc |
series | Advanced materials research ; |
series2 | Advanced materials research, |
spelling | International Conference on Advances in Materials and Manufacturing Processes (2010 : Shenzhen Shi, China), issuing body. http://id.loc.gov/authorities/names/no2011015204 Advanced manufacturing technology : selected, peer reviewed papers from the 2010 International Conference on Advances in Materials and Manufacturing Processes (ICAMMP 2010), 6-8 November, 2010, Shenzhen, China / edited by Jingtao Han, Zhengyi Jiang and Sihai Jiao. ICAMMP 2010 Stafa-Zurich, Switzerland ; Enfield, NH : Trans Tech Publications, [2011] ©2011 1 online resource (1778 pages) : illustrations (some color) text txt rdacontent computer c rdamedia online resource cr rdacarrier Advanced materials research, 1022-6680 ; volumes 156-157 Includes bibliographical references and indexes. Print version record. "This book aims to collect the latest advancement and applications of robotics, artificial intelligence, programmable controllers, lasers and other advanced processes, programmable assembly, flexible manufacturing systems, inspection; automatic test equipment, simulation, motors, controls and drives, local area networking, computer integrated manufacturing, production planning and control, logistics and supply chain management, human factors, and economics"--Preface Advanced Manufacturing Technology, ICAMMP 2010; Sponsors, Preface; Table of Contents; Development of a Multi-Quantum-Well Spatial Light Modulator and its Nonlinear Electro-Optical Driving Circuit; Study on the Algorithms of Holes Feature Recognition in Auto Body Panels Based on UG; A Two-Stage Optimization Method for the Stencil Printing Process Based on Neural Network and Response Surface Method; A Joint Model of Production and Preventive Maintenance Plan; Processing of Human Feces Using Beanstalk and Sawdust as Matrix in a Composting-Type Eco-Toilet Study and Preparation of Electrocatalytic Ceramic Membrane ElectrodeAugmented Product Modeling Technique in New Product Development; Adsorption of Arsenic (III) onto Modified Magnetic Microspheres; Preparation of Novel Amino-Functionalized Ionic Liquids and their Application; Multi-Population Multi-Objective Cultural Algorithm; Quick Verification Technology of Coordinate Measuring Arm; Matter Element Digraph Based Workflow Modeling; A New Experimental Approach for Determination the Effect of Tool Flank Wear Length on Cutting Temperature Distributions Characteristic of Cu-Based Catalytic Coating for Methanol Steam Reforming Prepared by Cold SprayResearch Finite Element Method Mesh Generation Based on Material-Discontinuous-Nature; Comprehensive Evaluation Index System in the Application for Earthquake Emergency Shelter Site; Experimental Study on New Technology for Solidifying/Stabilizing Papermaking Sludge; Numerical Simulation for Magnetic Fluid Inclination Sensor; Effect of Process Parameters on Solid Fuel Briquette of Rice and Soybean Straw; A Fast Retrieval Method Based on K-Means Clustering for Mechanical Product Design Research on the Optimization Algorithm of NC Tool-Path for Scanning PointsCrystal Structure and Electrochemical Properties of AB3.8-Type Earth Mg Ni-Based Hydrogen Storage Alloys; A Novel Evaluation Method for Overall Performance Testing of Rail Transit Brake System; Finite Element Analysis of Temperature Characteristicon the Pressure Sensor Based on the Shell of Piezo Gauge; Study on Energy-Saving Product Concept Design Based on TRIZ and Function Analysis; Treatment of Lake-Type Raw Water by Ultrasonic and Photocatalytic Oxidization Process Materials science Congresses. Manufacturing processes Data processing Congresses. Manufacturing processes Automation Congresses. Production control Automation Congresses. CAD/CAM systems. http://id.loc.gov/authorities/subjects/sh85018610 Science des matériaux Congrès. Fabrication Informatique Congrès. Fabrication Automatisation Congrès. Production Contrôle Automatisation Congrès. Systèmes de CFAO. TECHNOLOGY & ENGINEERING Industrial Engineering. bisacsh TECHNOLOGY & ENGINEERING Industrial Technology. bisacsh TECHNOLOGY & ENGINEERING Manufacturing. bisacsh TECHNOLOGY & ENGINEERING Technical & Manufacturing Industries & Trades. bisacsh CAD/CAM systems fast Manufacturing processes Automation fast Manufacturing processes Data processing fast Materials science fast Production control Automation fast proceedings (reports) aat Conference papers and proceedings fast Conference papers and proceedings. lcgft http://id.loc.gov/authorities/genreForms/gf2014026068 Actes de congrès. rvmgf Han, Jingtao. http://id.loc.gov/authorities/names/nb2011001690 Jiang, Zhengyi. Jiao, Sihai. http://id.loc.gov/authorities/names/no2011011798 has work: Advanced manufacturing technology (Text) https://id.oclc.org/worldcat/entity/E39PCGVVhHHy49jMqhvV9gDMMX https://id.oclc.org/worldcat/ontology/hasWork Print version: International Conference on Advances in Materials and Manufacturing Processes. Advanced manufacturing technology : selected, peer reviewed papers from the 2010 International Conference on Advances in Materials and Manufacturing Processes (ICAMMP 2010), 6-8 November, 2010, Shenzhen, China. Stafa-Zurich, Switzerland : Trans Tech Publications, [2011] 2 volumes in 1 ; 25 cm. Advanced materials research ; volumes 156-157 1022-6680 9780878492053 (DLC) 2011286720 (OCoLC)751515820 Advanced materials research ; v. 156-157. http://id.loc.gov/authorities/names/n99255722 |
spellingShingle | Advanced manufacturing technology : selected, peer reviewed papers from the 2010 International Conference on Advances in Materials and Manufacturing Processes (ICAMMP 2010), 6-8 November, 2010, Shenzhen, China / Advanced materials research ; Advanced Manufacturing Technology, ICAMMP 2010; Sponsors, Preface; Table of Contents; Development of a Multi-Quantum-Well Spatial Light Modulator and its Nonlinear Electro-Optical Driving Circuit; Study on the Algorithms of Holes Feature Recognition in Auto Body Panels Based on UG; A Two-Stage Optimization Method for the Stencil Printing Process Based on Neural Network and Response Surface Method; A Joint Model of Production and Preventive Maintenance Plan; Processing of Human Feces Using Beanstalk and Sawdust as Matrix in a Composting-Type Eco-Toilet Study and Preparation of Electrocatalytic Ceramic Membrane ElectrodeAugmented Product Modeling Technique in New Product Development; Adsorption of Arsenic (III) onto Modified Magnetic Microspheres; Preparation of Novel Amino-Functionalized Ionic Liquids and their Application; Multi-Population Multi-Objective Cultural Algorithm; Quick Verification Technology of Coordinate Measuring Arm; Matter Element Digraph Based Workflow Modeling; A New Experimental Approach for Determination the Effect of Tool Flank Wear Length on Cutting Temperature Distributions Characteristic of Cu-Based Catalytic Coating for Methanol Steam Reforming Prepared by Cold SprayResearch Finite Element Method Mesh Generation Based on Material-Discontinuous-Nature; Comprehensive Evaluation Index System in the Application for Earthquake Emergency Shelter Site; Experimental Study on New Technology for Solidifying/Stabilizing Papermaking Sludge; Numerical Simulation for Magnetic Fluid Inclination Sensor; Effect of Process Parameters on Solid Fuel Briquette of Rice and Soybean Straw; A Fast Retrieval Method Based on K-Means Clustering for Mechanical Product Design Research on the Optimization Algorithm of NC Tool-Path for Scanning PointsCrystal Structure and Electrochemical Properties of AB3.8-Type Earth Mg Ni-Based Hydrogen Storage Alloys; A Novel Evaluation Method for Overall Performance Testing of Rail Transit Brake System; Finite Element Analysis of Temperature Characteristicon the Pressure Sensor Based on the Shell of Piezo Gauge; Study on Energy-Saving Product Concept Design Based on TRIZ and Function Analysis; Treatment of Lake-Type Raw Water by Ultrasonic and Photocatalytic Oxidization Process Materials science Congresses. Manufacturing processes Data processing Congresses. Manufacturing processes Automation Congresses. Production control Automation Congresses. CAD/CAM systems. http://id.loc.gov/authorities/subjects/sh85018610 Science des matériaux Congrès. Fabrication Informatique Congrès. Fabrication Automatisation Congrès. Production Contrôle Automatisation Congrès. Systèmes de CFAO. TECHNOLOGY & ENGINEERING Industrial Engineering. bisacsh TECHNOLOGY & ENGINEERING Industrial Technology. bisacsh TECHNOLOGY & ENGINEERING Manufacturing. bisacsh TECHNOLOGY & ENGINEERING Technical & Manufacturing Industries & Trades. bisacsh CAD/CAM systems fast Manufacturing processes Automation fast Manufacturing processes Data processing fast Materials science fast Production control Automation fast |
subject_GND | http://id.loc.gov/authorities/subjects/sh85018610 http://id.loc.gov/authorities/genreForms/gf2014026068 |
title | Advanced manufacturing technology : selected, peer reviewed papers from the 2010 International Conference on Advances in Materials and Manufacturing Processes (ICAMMP 2010), 6-8 November, 2010, Shenzhen, China / |
title_alt | ICAMMP 2010 |
title_auth | Advanced manufacturing technology : selected, peer reviewed papers from the 2010 International Conference on Advances in Materials and Manufacturing Processes (ICAMMP 2010), 6-8 November, 2010, Shenzhen, China / |
title_exact_search | Advanced manufacturing technology : selected, peer reviewed papers from the 2010 International Conference on Advances in Materials and Manufacturing Processes (ICAMMP 2010), 6-8 November, 2010, Shenzhen, China / |
title_full | Advanced manufacturing technology : selected, peer reviewed papers from the 2010 International Conference on Advances in Materials and Manufacturing Processes (ICAMMP 2010), 6-8 November, 2010, Shenzhen, China / edited by Jingtao Han, Zhengyi Jiang and Sihai Jiao. |
title_fullStr | Advanced manufacturing technology : selected, peer reviewed papers from the 2010 International Conference on Advances in Materials and Manufacturing Processes (ICAMMP 2010), 6-8 November, 2010, Shenzhen, China / edited by Jingtao Han, Zhengyi Jiang and Sihai Jiao. |
title_full_unstemmed | Advanced manufacturing technology : selected, peer reviewed papers from the 2010 International Conference on Advances in Materials and Manufacturing Processes (ICAMMP 2010), 6-8 November, 2010, Shenzhen, China / edited by Jingtao Han, Zhengyi Jiang and Sihai Jiao. |
title_short | Advanced manufacturing technology : |
title_sort | advanced manufacturing technology selected peer reviewed papers from the 2010 international conference on advances in materials and manufacturing processes icammp 2010 6 8 november 2010 shenzhen china |
title_sub | selected, peer reviewed papers from the 2010 International Conference on Advances in Materials and Manufacturing Processes (ICAMMP 2010), 6-8 November, 2010, Shenzhen, China / |
topic | Materials science Congresses. Manufacturing processes Data processing Congresses. Manufacturing processes Automation Congresses. Production control Automation Congresses. CAD/CAM systems. http://id.loc.gov/authorities/subjects/sh85018610 Science des matériaux Congrès. Fabrication Informatique Congrès. Fabrication Automatisation Congrès. Production Contrôle Automatisation Congrès. Systèmes de CFAO. TECHNOLOGY & ENGINEERING Industrial Engineering. bisacsh TECHNOLOGY & ENGINEERING Industrial Technology. bisacsh TECHNOLOGY & ENGINEERING Manufacturing. bisacsh TECHNOLOGY & ENGINEERING Technical & Manufacturing Industries & Trades. bisacsh CAD/CAM systems fast Manufacturing processes Automation fast Manufacturing processes Data processing fast Materials science fast Production control Automation fast |
topic_facet | Materials science Congresses. Manufacturing processes Data processing Congresses. Manufacturing processes Automation Congresses. Production control Automation Congresses. CAD/CAM systems. Science des matériaux Congrès. Fabrication Informatique Congrès. Fabrication Automatisation Congrès. Production Contrôle Automatisation Congrès. Systèmes de CFAO. TECHNOLOGY & ENGINEERING Industrial Engineering. TECHNOLOGY & ENGINEERING Industrial Technology. TECHNOLOGY & ENGINEERING Manufacturing. TECHNOLOGY & ENGINEERING Technical & Manufacturing Industries & Trades. CAD/CAM systems Manufacturing processes Automation Manufacturing processes Data processing Materials science Production control Automation proceedings (reports) Conference papers and proceedings Conference papers and proceedings. Actes de congrès. |
work_keys_str_mv | AT internationalconferenceonadvancesinmaterialsandmanufacturingprocessesshenzhenshichina advancedmanufacturingtechnologyselectedpeerreviewedpapersfromthe2010internationalconferenceonadvancesinmaterialsandmanufacturingprocessesicammp201068november2010shenzhenchina AT hanjingtao advancedmanufacturingtechnologyselectedpeerreviewedpapersfromthe2010internationalconferenceonadvancesinmaterialsandmanufacturingprocessesicammp201068november2010shenzhenchina AT jiangzhengyi advancedmanufacturingtechnologyselectedpeerreviewedpapersfromthe2010internationalconferenceonadvancesinmaterialsandmanufacturingprocessesicammp201068november2010shenzhenchina AT jiaosihai advancedmanufacturingtechnologyselectedpeerreviewedpapersfromthe2010internationalconferenceonadvancesinmaterialsandmanufacturingprocessesicammp201068november2010shenzhenchina AT internationalconferenceonadvancesinmaterialsandmanufacturingprocessesshenzhenshichina icammp2010 AT hanjingtao icammp2010 AT jiangzhengyi icammp2010 AT jiaosihai icammp2010 |